DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12898 and CG33922

DIOPT Version :9

Sequence 1:NP_610581.1 Gene:CG12898 / 36096 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster


Alignment Length:132 Identity:28/132 - (21%)
Similarity:46/132 - (34%) Gaps:24/132 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LESLETNC---DHDYVEY---FRKVPNTKLLYTFRVVKLAPAFTIDITVKVVKTQRI-----FYK 65
            ||.....|   |.::..:   |.|..|....|....|||......::.:.:...||:     |..
  Fly    24 LEFTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYSLKVKLLKTPVSNVKINIATFQRLNGYKPFLY 88

  Fly    66 MENIKGCDFL----NNPLLFKMFGEVYNHLVVNGSYFKCPIKPKVYYLK------NEGTVSIIPS 120
            ...:.||.|.    :||:....|....::..:|.|   ||....:...|      |....:::|.
  Fly    89 NVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHS---CPYDHDIILDKVSISHANTQVTNVLPV 150

  Fly   121 IH 122
            .|
  Fly   151 PH 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12898NP_610581.1 DUF1091 48..129 CDD:284008 17/90 (19%)
CG33922NP_001027217.1 DUF1091 72..156 CDD:284008 17/84 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.