powered by:
                   
 
    
    
             
          
            Protein Alignment CG12898 and CG33920
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_610581.1 | Gene: | CG12898 / 36096 | FlyBaseID: | FBgn0033516 | Length: | 156 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_001027214.1 | Gene: | CG33920 / 3771875 | FlyBaseID: | FBgn0053920 | Length: | 180 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 155 | Identity: | 34/155 - (21%) | 
          
            | Similarity: | 55/155 -  (35%) | Gaps: | 52/155 - (33%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly     3 FQKGNIEFILESLETN-CDHDYVEYFRKVPNTKLLYTFRVVKLAPAFTIDITVKVVKTQRIFYKM 66|:..||  :..||:.. .|.:|. |.:.|..:   |.:..:| |..|...||    |...:..|.
 Fly    25 FEFTNI--MCNSLDKQFSDFEYC-YIKSVNRS---YKYVSIK-AKLFKTPIT----KINGVILKR 78
 
 
  Fly    67 EN-------------IKGCDFLN----NPLLFKMFGEV-----------YNH-LVVNGSYFKCPI 102.|             :..|.|:|    ||:...::..:           |:| ||:.    |.||
 Fly    79 FNGYNGYRPFMFNITLDACRFMNNTKSNPIASYLYDFIRPFTNMNHNCPYDHDLVIE----KLPI 139
 
 
  Fly   103 KPKVYYLKNEGTVSIIPSIHPPGRF 127:..|.....::|.  |.|.:
 Fly   140 -----HFVNHQVTKVLPV--PEGDY 157
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR20898 | 
          
            | Phylome | 0 | 0.000 | Not matched by this tool. | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 1 | 1.100 |  | 
        
      
           
             Return to query results.
             Submit another query.