DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12898 and CG33768

DIOPT Version :10

Sequence 1:NP_610581.1 Gene:CG12898 / 36096 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001027142.2 Gene:CG33768 / 3771840 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster


Alignment Length:71 Identity:18/71 - (25%)
Similarity:32/71 - (45%) Gaps:3/71 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 CDFLNNPLLFKMFGEVYNHLVVNGSYFK-CPIKPKVYYLKN-EGTVSIIPSIHPPGRFQLSMRVR 134
            |:.|:. |...:|......:..|.::.: ||:....||||. ...:.::||....|.:.||..|.
  Fly    88 CELLST-LKDSLFRRWIKSVSKNSNFMENCPVPAGHYYLKGWHVEMGLVPSYLLSGDYLLSALVY 151

  Fly   135 MAESRA 140
            ..:.|:
  Fly   152 YGKYRS 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12898NP_610581.1 DUF1091 58..129 CDD:461928 14/58 (24%)
CG33768NP_001027142.2 DM8 76..167 CDD:214778 18/71 (25%)

Return to query results.
Submit another query.