DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12898 and CG14491

DIOPT Version :10

Sequence 1:NP_610581.1 Gene:CG12898 / 36096 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_611276.1 Gene:CG14491 / 37046 FlyBaseID:FBgn0034284 Length:166 Species:Drosophila melanogaster


Alignment Length:141 Identity:30/141 - (21%)
Similarity:51/141 - (36%) Gaps:39/141 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VEYFRKVPNTKLLYTFRVVKLAPAFTIDITVKVVKTQRIFYKMENIKGCDFLN--NPLLFKMFGE 86
            :|...|.|..|.....|:| |...|..|.|:         :.:..|.||..|:  |.:.|...|.
  Fly    35 IELQFKKPVAKFFVNMRIV-LPRRFGDDFTL---------FNLSGIDGCSLLSNKNQIAFIQLGR 89

  Fly    87 VYNHLVVNGSYFKCPIKPKV-YYLKN-EGTVSIIPSIHPPGRFQLSMRVRMAESRAPFVMEMLW- 148
            .:.....|... :||....| ||::. ...::.:|:.:    |:..|.              || 
  Fly    90 KHMDRFSNIPK-RCPWPKDVNYYIRGFRSDMATMPAFN----FETDMN--------------LWF 135

  Fly   149 -----KYKIVR 154
                 ::|::|
  Fly   136 ELVVNQHKLIR 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12898NP_610581.1 DUF1091 58..129 CDD:461928 15/74 (20%)
CG14491NP_611276.1 DM8 60..150 CDD:214778 22/115 (19%)

Return to query results.
Submit another query.