DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12898 and CG33467

DIOPT Version :10

Sequence 1:NP_610581.1 Gene:CG12898 / 36096 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:97 Identity:18/97 - (18%)
Similarity:28/97 - (28%) Gaps:42/97 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FTIDITVKV-------------VKTQRIFYKMENIKGCDFLNNPLLFKMFGEVYNHLVVNGSYFK 99
            |.||.|.|:             |....:|.:..|:|.|             .:...|.....|..
  Fly    86 FLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVKSC-------------HISGQLSARNGYLN 137

  Fly   100 CPIKPKVYYLKNEGTVSIIPSIHPPGRFQLSM 131
            .               |.:|.. |.|::|:|:
  Fly   138 S---------------SYVPPF-PHGQYQISV 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12898NP_610581.1 DUF1091 58..129 CDD:461928 10/70 (14%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:461928 16/93 (17%)

Return to query results.
Submit another query.