DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12898 and CG33475

Sequence 1:NP_610581.1 Gene:CG12898 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_995799.1 Gene:CG33475 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster

Alignment Length:141 Identity:45/142 (32%)
Similarity:75/142 (53%) Gaps:1/142 (1%)


  Fly    15 LETNCDHDYVEYFRKVPNTKLLYTFRVVKLAPAFTIDITVKVVKTQRIFYKMENIKGCDFLNNPL 79
            ||...:...|:||..||...........||.....:|..::...:.|..|.::|:..|:||||.|
  Fly     8 LELKYNRSNVDYFGLVPGESQKMMINSTKLFKNIFLDNRIQNAVSNRTIYNIKNLAICNFLNNRL 72

  Fly    80 LFKMFGEVYNHLVVNGSYFKCPIKPKVYYLKNEGTVSIIPSIHPPGRFQLSMRVRMAESRAPFVM 144
            :.|::..:|...|.|.:.|:||::|.||||.|......:|..|.||.|:|.:::: ||.....:.
  Fly    73 ISKVYSVIYEGFVGNSTVFRCPVQPSVYYLSNSVREFEVPIFHQPGMFRLYVKLK-AEKEGNMLT 136

  Fly   145 EMLWKYKIVRI 155
            |::|:|::.||
  Fly   137 ELIWRYRVRRI 147

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12898NP_610581.1 DUF1091 48..129 CDD:284008 28/81 (35%)
CG33475NP_995799.1 DUF1091 54..122 CDD:284008 27/68 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140886276
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.