DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12898 and CG33475

DIOPT Version :9

Sequence 1:NP_610581.1 Gene:CG12898 / 36096 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster


Alignment Length:141 Identity:45/141 - (31%)
Similarity:75/141 - (53%) Gaps:1/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LETNCDHDYVEYFRKVPNTKLLYTFRVVKLAPAFTIDITVKVVKTQRIFYKMENIKGCDFLNNPL 79
            ||...:...|:||..||...........||.....:|..::...:.|..|.::|:..|:||||.|
  Fly     8 LELKYNRSNVDYFGLVPGESQKMMINSTKLFKNIFLDNRIQNAVSNRTIYNIKNLAICNFLNNRL 72

  Fly    80 LFKMFGEVYNHLVVNGSYFKCPIKPKVYYLKNEGTVSIIPSIHPPGRFQLSMRVRMAESRAPFVM 144
            :.|::..:|...|.|.:.|:||::|.||||.|......:|..|.||.|:|.:::: ||.....:.
  Fly    73 ISKVYSVIYEGFVGNSTVFRCPVQPSVYYLSNSVREFEVPIFHQPGMFRLYVKLK-AEKEGNMLT 136

  Fly   145 EMLWKYKIVRI 155
            |::|:|::.||
  Fly   137 ELIWRYRVRRI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12898NP_610581.1 DUF1091 58..129 CDD:461928 27/70 (39%)
CG33475NP_995799.1 DUF1091 52..122 CDD:461928 27/69 (39%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - -
Domainoid 1 1.000 - -
eggNOG 1 0.900 - -