DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: KCNQ and Kcnq1

Sequence 1:NP_788300.3 Gene:KCNQ FlyBaseID:FBgn0033494 Length:993 Species:Drosophila melanogaster
Sequence 2:NP_114462.1 Gene:Kcnq1 RGDID:621503 Length:669 Species:Rattus norvegicus

Alignment Length:703 Identity:266/704 (38%)
Similarity:364/704 (52%) Gaps:188/704 (27%)


  Fly    25 PNSERILQPRMSLLGKPLNYNRGTRRDVRYR-RLQSRLYNFLERPRGLHAIFYHVMVFLMVFTCL 88
            |.....|.||:|:.        .|||.:..| .:|.|:|||||||.|.....||..|||:|..||
  Rat    81 PRPRVSLDPRVSIY--------STRRPLLARTHIQGRVYNFLERPTGWKCFVYHFTVFLIVLVCL 137

  Fly    89 ALSVFSTIKEYEEDAVYILFRMEILVVIWFTMEFGARLWSSGCRSRYQGCLGRLKFVKRPFCIID 153
            ..||.|||::|...|...||.|||::|::|..|:..||||:||||:|.|..|||:|.::|..|||
  Rat   138 IFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGIWGRLRFARKPISIID 202

  Fly   154 IVTILASIVVLGMGTSGQVFATSALRGLRFFQILRMVRMDRRGGTWKLLGSVVYAHRQELITTMY 218
            ::.::||:|||.:|:.||||||||:||:||.|||||:.:||:||||:||||||:.||||||||:|
  Rat   203 LIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLY 267

  Fly   219 IGFLGLIFASFLVYMWEKD-VND----KFSNFAQALWWGVITLCTVGYGDMVPITWQGKLIASCC 278
            ||||||||:|:.||:.||| ||:    :|.::|.||||||:|:.|:||||.||.||.||.||||.
  Rat   268 IGFLGLIFSSYFVYLAEKDAVNESGRIEFGSYADALWWGVVTVTTIGYGDKVPQTWVGKTIASCF 332

  Fly   279 ALLGISFFALPAGILGSGFALKVQQQQRQKHMIRRRQPAATLIQAVWRCYAADEHSVSVATWNIH 343
            ::..|||||||||||||||||||||:|||||..|:...||:|||..||||||:....|  ||.|:
  Rat   333 SVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSS--TWKIY 395

  Fly   344 RVALPSPPASRASSSFKHNTSFVARLPTIRRHKSQTIQTPGGGDGGGVSKPPGSSRASTRYTRTI 408
                                   .|.|.    :|.|:.:|.       .||..|.....:..:..
  Rat   396 -----------------------VRKPA----RSHTLLSPS-------PKPKKSVMVKKKKFKLD 426

  Fly   409 RDINASVENLEVVQNGKSMNPSFSEDSVAETTCLKNIKNSDASQPATLANCKLSSSAGSLAQFPD 473
            :|            ||  ::|.....:|...||                                
  Rat   427 KD------------NG--LSPGEKIFNVPHITC-------------------------------- 445

  Fly   474 RNRDRDQDRR-GHGEGEGDQAEEQAKAGGSRRNLT-IPVVLYGFLHGNFLGSTLSLRNPRVAPAN 536
               |..:||| .|...:|..:       ..|::.| :.|....||..|..             |.
  Rat   446 ---DPPEDRRPDHFSIDGYDS-------SVRKSPTLLEVSTPHFLRTNSF-------------AE 487

  Fly   537 DRDLEAGRDEDEVHKDTCQRSNTLPLPVKPDSPSGSPGSGRTGRFFAAASHFLETGFSSPNPIID 601
            |.|||               ..||..|:                     :|              
  Rat   488 DLDLE---------------GETLLTPI---------------------TH-------------- 502

  Fly   602 VANEEDEPRCTQLTNRHKTAIRFIRKLKYFVARRKFKEALKPYDVKDVMEQYAAGHVDLLGRVKM 666
                     .:||.:.|:..|:.||:::||||::||::|.|||||:||:|||:.||::|:.|:|.
  Rat   503 ---------VSQLRDHHRATIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKE 558

  Fly   667 LHLRLDQILGKQ------GSKAKDVYASKISLASRVVKVERQVADIEEKLDIL 713
            |..||||.:||.      ..|:||  ....::.:|:.:||.:|..::::|.|:
  Rat   559 LQRRLDQSIGKPSLFIPISEKSKD--RGSNTIGARLNRVEDKVTQLDQRLVII 609

Known Domains:


GeneSequenceDomainRegion External IDIdentity
KCNQNP_788300.3 Ion_trans 100..305 CDD:278921 132/210 (63%)
Ion_trans_2 221..295 CDD:285168 50/79 (63%)
KCNQ_channel <619..719 CDD:281513 41/102 (40%)
Kcnq1NP_114462.1 Ion_trans 153..359 CDD:278921 131/206 (64%)
Ion_trans_2 270..349 CDD:285168 50/79 (63%)
Selectivity filter. {ECO:0000250} 312..317 4/5 (80%)
KCNQ_channel <511..617 CDD:281513 41/102 (40%)
Interaction with KCNE1 C-terminus. {ECO:0000250|UniProtKB:P51787} 535..572 21/37 (57%)
Interaction with AKAP9. {ECO:0000250|UniProtKB:P51787} 588..616 6/23 (26%)
C-terminal assembly domain. {ECO:0000250|UniProtKB:P51787} 589..620 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2126
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1168835at2759
OrthoFinder 1 1.000 FOG0000739
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
54.870

Return to query results.
Submit another query.