DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: KCNQ and kqt-2

Sequence 1:NP_788300.3 Gene:KCNQ FlyBaseID:FBgn0033494 Length:993 Species:Drosophila melanogaster
Sequence 2:NP_509392.3 Gene:kqt-2 WormBaseID:WBGene00002234 Length:695 Species:Caenorhabditis elegans

Alignment Length:773 Identity:169/774 (22%)
Similarity:280/774 (36%) Gaps:243/774 (31%)


  Fly    45 NRGTRRDVRYRRLQSRLYNFLERPRGLHAIFYHVMVFLMVFTCLALSVFSTIKEYEEDAVYILFR 109
            |.|.:|....||::.::|||||:|....:..||..:|.:|...:.|.  :...:.:.....|.|.
 Worm    65 NLGNQRQRNLRRIRLKVYNFLEKPLNAASAPYHFFIFGLVIANIILG--AATNDNDSTVSKIHFF 127

  Fly   110 MEILVVIWFTMEFGARLWSSGCRSRYQGCLGRLKFVKRPFCIIDIVTILASIVVL---GMGTSGQ 171
            :||.::::|.:||..||||....::|:...|||.::.....:|||:.|.|:|::|   |....| 
 Worm   128 LEIFMIVFFILEFAVRLWSVRADAKYRTKYGRLYYLFHTVTLIDILIIPATILLLVFKGHDVDG- 191

  Fly   172 VFATSALRGLRFFQILRMVRMDRRGGTWKLLGSVVYAHRQELITTMYIGF-LGLIFASFLVYMWE 235
                |.|..|||.||||:..:||:..|||||..::...:.:|:.|.||.. :||..|: :||..|
 Worm   192 ----STLDTLRFIQILRLFHVDRQMATWKLLRKMIILGKWQLMATYYITLVVGLSLAT-IVYSTE 251

  Fly   236 ----------------KDVNDKFSNFAQALWWGVITLCTVGYGDMVPITWQGKLIASCCALLGIS 284
                            :..|..|...|.:.|:..:|:.||||||:.|:....|.:.  |.|..|:
 Worm   252 ALAQGIQDNGYGLIVPEGTNATFPTMAHSWWFTAVTVMTVGYGDIYPVGALTKFLV--CVLGFIA 314

  Fly   285 FFALPAG--ILGSGFALKVQQQQRQKHMIRRRQPAATLIQAVWRCYAADEHSVSVATWNIHRVAL 347
            |....|.  .:..|..|.::::.:.:...|.|..||:.||..||.:.|       ..|       
 Worm   315 FCTFQAANTQISVGLTLMMEEENKNQQTNRLRNLAASTIQCWWRYHLA-------TNW------- 365

  Fly   348 PSPPASRASSSFKHNTSFVARLPTIRRHKSQTIQTPGGGDGGGVSKPPGSSRASTRYTRTIRDIN 412
                                                         |||      .|||..:.   
 Worm   366 ---------------------------------------------KPP------RRYTYFVH--- 376

  Fly   413 ASVENLEVVQNGKSMNPSFSEDSVAETTCLK-NIKNSDASQPATLANCKLSSSAGSLAQFPDRNR 476
                                       .|.| .:.....:|...||. ||              |
 Worm   377 ---------------------------VCYKLYVTEERINQNRVLAK-KL--------------R 399

  Fly   477 DRDQDRRGHGEGEGDQAEEQAKAGGSRRNLTIPVVLYGFLHGNFLGSTLSLRNPRVAPANDRD-- 539
            ::.:.:|          ..:.|:...:.::|..::.:||         ..:..|.:...:..|  
 Worm   400 EKLEKKR----------PIKKKSLTHQNSVTAEILKFGF---------KGMAKPMLEKQDSFDKA 445

  Fly   540 -----LEAGRDEDEVHKDTCQRSNTLP--LPVKPDSPSGSPGSGRTGRFFAAASHFLETGFSSPN 597
                 |...|.||        |.::||  |.|.      .|...:...|..|.:..:||..||. 
 Worm   446 ERKISLRRTRSED--------RRSSLPDTLAVV------DPAIRKRVLFAEARNSSVETSMSSS- 495

  Fly   598 PIIDVANEEDEPRCTQLTN--------------------RHKTAIRFIRKLKYFVARRKFKEALK 642
              :||:..|.:   .::||                    :::..:||.    |||   .|:..:.
 Worm   496 --VDVSELETQ---FEITNFLEQNVDELSSKEVDISLLIKYRPLLRFY----YFV---MFRFIMN 548

  Fly   643 PYDVKDVMEQYAAGHVDLLGR-------VKMLHLRLDQILGKQGSKAKDVYASKISLASRVVKVE 700
            .:..:.:..|......::..|       :|.|...:.::.||......|....|:|:..|:...|
 Worm   549 KFHTQRIAGQLLMIEAEIAERENQRNQKMKELEAAILELTGKPTVSPFDDSGQKLSIIERLEFCE 613

  Fly   701 RQVADIEEKLDIL-------IKAYMEDRDRFLALP-----LPAKP------KIHSISP 740
            :::.|:|.|.|.|       :...|.|.....:..     ||.||      |..:|.|
 Worm   614 KRMEDLERKTDALNEITIKCLNLMMMDTQEAASRTKDEQGLPPKPPSANNKKQRTIGP 671

Known Domains:


GeneSequenceDomainRegion External IDIdentity
KCNQNP_788300.3 Ion_trans 100..305 CDD:278921 70/227 (31%)
Ion_trans_2 221..295 CDD:285168 24/93 (26%)
KCNQ_channel <619..719 CDD:281513 23/114 (20%)
kqt-2NP_509392.3 Ion_trans 123..318 CDD:278921 67/203 (33%)
Ion_trans_2 <282..318 CDD:285168 14/38 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4173
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1168835at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11537
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.920

Return to query results.
Submit another query.