DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: KCNQ and Kcnq3

Sequence 1:NP_788300.3 Gene:KCNQ FlyBaseID:FBgn0033494 Length:993 Species:Drosophila melanogaster
Sequence 2:NP_690887.2 Gene:Kcnq3 MGIID:1336181 Length:873 Species:Mus musculus

Alignment Length:1021 Identity:301/1022 (29%)
Similarity:433/1022 (42%) Gaps:348/1022 (34%)


  Fly    23 GRPNSERILQPRMSLLGK-PLNYNRGTRR-DVRYRRLQSRLYNFLERPRGLHAIFYHVMVFLMVF 85
            ||...:|.....:.||.| ||  :|..:| :.:|||:|:.:|:.|||||| .|:.||.:|||:|.
Mouse    74 GREEGQRRTPQGIGLLAKTPL--SRPVKRNNAKYRRIQTLIYDALERPRG-WALLYHALVFLIVL 135

  Fly    86 TCLALSVFSTIKEYEEDAVYILFRMEILVVIWFTMEFGARLWSSGCRSRYQGCLGRLKFVKRPFC 150
            .||.|:|.:|.||||..:...|..:|...:..|..||..|:|::||..||:|..|||||.::|.|
Mouse   136 GCLILAVLTTFKEYETVSGDWLLLLETFAIFIFGAEFALRIWAAGCCCRYKGWRGRLKFARKPLC 200

  Fly   151 IIDIVTILASIVVLGMGTSGQVFATSALRGLRFFQILRMVRMDRRGGTWKLLGSVVYAHRQELIT 215
            ::||..::||:.|:.:|..|.|.||| ||.|||.|||||:||||||||||||||.:.||.:||||
Mouse   201 MLDIFVLIASVPVVAVGNQGNVLATS-LRSLRFLQILRMLRMDRRGGTWKLLGSAICAHSKELIT 264

  Fly   216 TMYIGFLGLIFASFLVYMWEKDV----------NDKFSNFAQALWWGVITLCTVGYGDMVPITWQ 270
            ..|||||.||.:|||||:.||||          .::|..:|.|||||:|||.|:||||..|.||:
Mouse   265 AWYIGFLTLILSSFLVYLVEKDVPEMDAQGEEMKEEFETYADALWWGLITLATIGYGDKTPKTWE 329

  Fly   271 GKLIASCCALLGISFFALPAGILGSGFALKVQQQQRQKHMIRRRQPAATLIQAVWRCYAADEHSV 335
            |:|||:..:|:|:|||||||||||||.|||||:|.||||..:||:|||.||||.||.||.:.:.:
Mouse   330 GRLIAATFSLIGVSFFALPAGILGSGLALKVQEQHRQKHFEKRRKPAAELIQAAWRYYATNPNRL 394

  Fly   336 S-VATWNIHRVALPSPPASRASSSFKHNTSFVARLPTIRRHKSQTI--QTPGGGDGGGVSKPPGS 397
            . ||||..:                    ..|...|..|:.:.:..  |..|..|...:|.|.||
Mouse   395 DLVATWRFY--------------------ESVVSFPFFRKEQLEAAASQKLGLLDRVRLSNPRGS 439

  Fly   398 SRASTRYTRTIRDINASVENLEVVQNGKSMNPSFSEDSVAETTCLKNIKNSDASQPATLANCKLS 462
            :.....:|..         |::.::...|..|                      :|..|.|.:..
Mouse   440 NTKGKLFTPL---------NVDAIEESPSKEP----------------------KPVGLNNKERF 473

  Fly   463 SSAGSLAQFPDRNRDRDQDRRGHGEGEGD-QAEEQAKAGGSRRNLTIPVVLYGFLHGNFLGSTLS 526
            .:|..:..:.......|       .|.|| .||::.               ||   .:||     
Mouse   474 RTAFRMKAYAFWQSSED-------AGTGDPMAEDRG---------------YG---NDFL----- 508

  Fly   527 LRNPRVAPANDRDLEAGRDEDEVHKDTCQRSNTLPLPVKPDSPSGSPGSGRTGRFFAAASHFLET 591
                              .||.:                                          
Mouse   509 ------------------IEDMI------------------------------------------ 513

  Fly   592 GFSSPNPIIDVANEEDEPRCTQLTNRHKTAIRFIRKLKYFVARRKFKEALKPYDVKDVMEQYAAG 656
                  |.:                  |.|||.:|.|::.:.::||||.|:|||||||:|||:||
Mouse   514 ------PTL------------------KAAIRAVRILQFRLYKKKFKETLRPYDVKDVIEQYSAG 554

  Fly   657 HVDLLGRVKMLHLRLDQIL---------------------GKQGSKAKDVYASKI--------SL 692
            |:|:|.|:|.|..|:|.|.                     ..|.|...:.|.::.        |:
Mouse   555 HLDMLSRIKYLQTRIDMIFTPGPPSTPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSM 619

  Fly   693 ASRVVKVERQVADIEEKLDILIKAYMEDRDRFLALPLPAKPKIHSISPSHKPLHHAHNLAMIDVW 757
            ..:.|||||||.|:.:|||.|:..:|:..:|.         ::|                     
Mouse   620 MGKFVKVERQVHDMGKKLDFLVDMHMQHMERL---------QVH--------------------- 654

  Fly   758 KRTAALSVHPEQVTTTPLLNPSAPDS--SELRSLTATQTPTTTTDAIATQTPMPPHVQHTA---- 816
                ....:|.:..::|.......|:  |:|:::....:.|...|        ||:..|..    
Mouse   655 ----VTEYYPTKGASSPAEGEKKEDNRYSDLKTIICNYSETGPPD--------PPYSFHQVPIDR 707

  Fly   817 -------------------TNTKSSVLNSYQLGSEKQQHNDV--FMTELENRTKKRVTLSLHRST 860
                               ::||:.. |....||...:...|  .:|.|::      .:|.|..|
Mouse   708 VGPYGFFAHDPVKLTRGGPSSTKAQA-NLPSSGSTYAERPTVLPILTLLDS------CVSYHSQT 765

  Fly   861 --SEPYS-----KQEQRITIPDEGADSLDSSAKPTPPDSSIILIDEYEDFEEEDLNCEGEMDHFP 918
              ..|||     :|.:.||     .||          |:.:.|:         .:|.| |::..|
Mouse   766 ELQGPYSDHISPRQRRSIT-----RDS----------DTPLSLM---------SVNHE-ELERSP 805

  Fly   919 TWEIDSDIGVEVDVDAD-------------------ADGDCDESTE 945
            :       |..:..|.|                   |:|:.|..|:
Mouse   806 S-------GFSISQDRDDYVFGPSGGSSWMREKRYLAEGETDTDTD 844

Known Domains:


GeneSequenceDomainRegion External IDIdentity
KCNQNP_788300.3 Ion_trans 100..305 CDD:278921 120/215 (56%)
Ion_trans_2 221..295 CDD:285168 48/84 (57%)
KCNQ_channel <619..719 CDD:281513 49/129 (38%)
Kcnq3NP_690887.2 Ion_trans 140..364 CDD:278921 126/225 (56%)
Ion_trans_2 270..354 CDD:285168 48/84 (57%)
Selectivity filter. {ECO:0000250} 317..322 4/5 (80%)
Mediates interaction with calmodulin. {ECO:0000250|UniProtKB:O43525} 357..538 68/346 (20%)
KCNQ_channel 453..657 CDD:281513 70/374 (19%)
KCNQC3-Ank-G_bd 781..867 CDD:288784 17/97 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 521 1.000 Inparanoid score I1244
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1168835at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T615259
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11537
Phylome 1 0.910 0.727 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.930

Return to query results.
Submit another query.