DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: KCNQ and kcnq2a

Sequence 1:NP_788300.3 Gene:KCNQ FlyBaseID:FBgn0033494 Length:993 Species:Drosophila melanogaster
Sequence 2:NP_001108379.1 Gene:kcnq2a ZFINID:ZDB-GENE-080220-37 Length:349 Species:Danio rerio

Alignment Length:313 Identity:179/314 (57%)
Similarity:235/314 (75%) Gaps:15/314 (5%)


  Fly    23 GRPNSER---ILQPRMSLLGKPLNYNRGT---RRDVRYRRLQSRLYNFLERPRGLHAIFYHVMVF 81
            |..:::|   :.:||.|:       :||:   :|:.||||||:.|||.|||||| .|..||..||
Zfish    44 GSESTKRGSILCRPRSSI-------SRGSIAHKRNARYRRLQNFLYNALERPRG-WAFIYHAYVF 100

  Fly    82 LMVFTCLALSVFSTIKEYEEDAVYILFRMEILVVIWFTMEFGARLWSSGCRSRYQGCLGRLKFVK 146
            ::||:||.||||:|||||::.:...|:.:||:.::.|.:|:..|:|::||..||:|..|||:|.:
Zfish   101 VLVFSCLVLSVFATIKEYKKSSESALYILEIVTIVVFGVEYIVRIWAAGCCCRYRGWRGRLRFAR 165

  Fly   147 RPFCIIDIVTILASIVVLGMGTSGQVFATSALRGLRFFQILRMVRMDRRGGTWKLLGSVVYAHRQ 211
            :|||||||:.:.||:.||..|:.|.||||||:|.|||.|||||:|||||||||||||||||||.:
Zfish   166 KPFCIIDIMVLFASVSVLAAGSQGNVFATSAIRSLRFLQILRMLRMDRRGGTWKLLGSVVYAHSK 230

  Fly   212 ELITTMYIGFLGLIFASFLVYMWEKDVN-DKFSNFAQALWWGVITLCTVGYGDMVPITWQGKLIA 275
            ||||..|||||.||.||||||..|||.| :.|..:|.|||||::||.|:||||..|:||.|:|||
Zfish   231 ELITAWYIGFLCLILASFLVYSVEKDDNAEMFETYADALWWGLVTLTTIGYGDKFPVTWNGRLIA 295

  Fly   276 SCCALLGISFFALPAGILGSGFALKVQQQQRQKHMIRRRQPAATLIQAVWRCY 328
            :..:|:|::||||||||||||||||||:|.||||..:||.|||.|||.:.:.:
Zfish   296 ATFSLIGVAFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAAGLIQVILKTF 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
KCNQNP_788300.3 Ion_trans 100..305 CDD:278921 126/206 (61%)
Ion_trans_2 221..295 CDD:285168 47/75 (63%)
KCNQ_channel <619..719 CDD:281513
kcnq2aNP_001108379.1 Ion_trans 119..325 CDD:278921 126/206 (61%)
Ion_trans_2 240..315 CDD:285168 47/75 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D485399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11537
Phylome 1 0.910 0.778 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.