DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18011 and CG6689

DIOPT Version :9

Sequence 1:NP_610559.1 Gene:CG18011 / 36068 FlyBaseID:FBgn0033491 Length:985 Species:Drosophila melanogaster
Sequence 2:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster


Alignment Length:749 Identity:142/749 - (18%)
Similarity:249/749 - (33%) Gaps:206/749 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 IPTREPSARIRNRAAAASNVTPDTSRSPEPPET--------PSTEDAVSKSEPKLVSKVADQEHF 187
            :|.....:..|::..||........|.|:.|:|        ..||:::....|            
  Fly     5 VPNCRNFSDCRSKRNAAQQQRLGFFRFPKCPDTFKAWLAFCGYTEESLKLKNP------------ 57

  Fly   188 SVLIQNILDEEEAVVEDETAVKEESSEAVQVTEETEAPGQIVILN--SEAVTDTNPDENVYIYEH 250
            .:.|::..||     :.|.::|.|...|   .:.|..||.:..:|  .|:.:|....|......:
  Fly    58 CICIEHFKDE-----DIEGSLKFEMGLA---KKRTLRPGAVPCVNKSQESGSDRARKERSQRRRN 114

  Fly   251 EDVMDPNLDNVKVKPISCSSRLVAQAEESQSDDDIDEGETSNVVLFNFVDIKEKDEVDNIPEYLA 315
            ::::               :.|:|:.|......:....|..:|.|...|.:    |:|.:     
  Fly   115 QELV---------------AELLAEEEAKLIHPEATSFEQDSVYLSETVTM----ELDPL----- 155

  Fly   316 TVVKTSFEKL-TFQWCTVCKHCSLKCPTFESLFSHLSKAHKSRRDVYECPIEGCNKELKGRKFLA 379
                :..||| ..|.|..|.:      .|.:.|        ..:|:::          .....|.
  Fly   156 ----SGEEKLEELQKCRTCYN------DFTADF--------RAKDLFD----------PANSVLL 192

  Fly   380 MHLVLL------HAPVAEIPIYGSCPECKLTFSNILQYNKHSCAHVIKKKRGFRSYCEMCSLEFP 438
            .|:.::      |.|  :.|.. .||.||......:.               ||..|....|:..
  Fly   193 FHIEVISGVWISHKP--DEPRL-MCPACKSALDQAID---------------FREMCISTELKLS 239

  Fly   439 SWKRFNFHSQFHLEKHRPRAC---FVCDYATTNIDELFQHLNYSHEPVGTLFCDLCDRTFRDPSV 500
            ..|......|...|...|.:.   .:.|...||::|:        |..|.               
  Fly   240 QAKPSTDEVQIEAENENPISSDHDLISDTENTNVEEI--------EDAGG--------------- 281

  Fly   501 FMEHNKSHANVSSTTYSCSECMANFESRGRLNGHMRAMHGSVISCELCSREFATEATYNIHMKKH 565
              :|.:..|  :|...:..|.:............:....|:.|..||..:...         |:.
  Fly   282 --DHVEDEA--TSDDQTSQEAVDEVAESPAAQDPLSVALGAKIFKELLDQYTG---------KEK 333

  Fly   566 LIIEKDVHVCSTCGLLSDSRETLLAHVNSVKTACFGSKIDVELLRDA--------YVCEYCSSYF 622
            ..:.|...:.|.    ..::|.........::|...:|.:..|:|.|        :||:.|...|
  Fly   334 ARLRKGAPIASK----PKAKEKAAGEQKPKRSANPKTKEERNLIRRAQLRAKPPNFVCDQCGQAF 394

  Fly   623 KEKDCLQAH--RDSGVHKDGVFLCQPCGKEFPHMKLYRHHLRNYQQLRSDSTHRRLE-------I 678
            :....|:.|  |.:....   :.|..|.|.|     |..::||        .|.|:.       .
  Fly   395 RMSHNLRIHMLRHTRTKN---YQCTECPKTF-----YDAYMRN--------MHIRIRHRGETPFA 443

  Fly   679 CVYYMCDQENCTESYVNWNSLYTHKRRTHESASKQAEK--------SSKSAQEWVCQFCLKECRS 735
            |.:       |:|::....:...|:...|.:|.:...|        ..:.:..:.|:.|.|...|
  Fly   444 CGF-------CSETFAYPGARQKHESEVHNAAPRLIVKRINPKPMPKPRESVRYQCKLCQKHYAS 501

  Fly   736 KMSLSVHVARSHNNDNV-TCPLCNSSYKSHDALAKHHAYWHE--PIECPECFKIVKNRRNYDTHV 797
            |.:|..|: :||.:.|. .|..|:.||...:.| |.|...||  |::|..|.|....|.....| 
  Fly   502 KYALGWHI-KSHTDANAYKCQRCSKSYSDPNKL-KRHEMTHEKRPLQCDVCLKGFYQRTRLREH- 563

  Fly   798 NVVHSNKKRYSCSVCQKGFYHKSEMEAH--QKLH 829
            .::|:.::.|.|.||...|.:|..|::|  .|:|
  Fly   564 ELIHTGERPYWCEVCNVNFRYKYNMKSHANSKMH 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18011NP_610559.1 PRK14950 <98..>184 CDD:237864 11/60 (18%)
C2H2 Zn finger 488..508 CDD:275368 1/19 (5%)
C2H2 Zn finger 518..538 CDD:275368 1/19 (5%)
C2H2 Zn finger 545..565 CDD:275368 3/19 (16%)
C2H2 Zn finger 575..596 CDD:275371 2/20 (10%)
SFP1 <682..747 CDD:227516 13/72 (18%)
C2H2 Zn finger 754..775 CDD:275368 7/20 (35%)
C2H2 Zn finger 780..801 CDD:275368 5/20 (25%)
C2H2 Zn finger 809..829 CDD:275368 8/21 (38%)
C2H2 Zn finger 864..885 CDD:275368
C2H2 Zn finger 891..917 CDD:275368
CG6689NP_650051.1 THAP 2..96 CDD:283206 22/110 (20%)
zf-AD 167..240 CDD:214871 18/114 (16%)
zf-C2H2 385..407 CDD:278523 6/21 (29%)
C2H2 Zn finger 387..407 CDD:275368 5/19 (26%)
zf-H2C2_2 399..422 CDD:290200 6/25 (24%)
C2H2 Zn finger 415..436 CDD:275368 9/33 (27%)
C2H2 Zn finger 444..460 CDD:275368 3/22 (14%)
C2H2 Zn finger 492..512 CDD:275368 7/20 (35%)
C2H2 Zn finger 520..540 CDD:275368 7/20 (35%)
C2H2 Zn finger 547..567 CDD:275368 5/20 (25%)
zf-met 574..597 CDD:289631 8/22 (36%)
C2H2 Zn finger 575..591 CDD:275368 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24376
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.