DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12917 and NUC1

Sequence 1:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_012327.1 Gene:NUC1 SGDID:S000003744 Length:329 Species:Saccharomyces cerevisiae

Alignment Length:347 Identity:75/348 (22%)
Similarity:118/348 (34%) Gaps:95/348 (27%)


  Fly    64 SGVT--LLVYCSPSVFKETVCQDNGQFSVPLPMRCLSPMQPVTKHIRDGDCAGNLYAVGYTIDGK 126
            :|:|  ||...||:...||          |.| ....|...:..|..:.|.:| .:..|:.....
Yeast    17 TGLTYLLLNKHSPTQIIET----------PYP-PTQKPNSNIQSHSFNVDPSG-FFKYGFPGPIH 69

  Fly   127 DLELYRTCFDCGQGRLVYSQSDVYYKTFFPKRPF--VEFVADEMFSPQEAAAYMKSNIYF----- 184
            ||:.......|      |::.        .:.|:  :|.:..|..:.:.|.   :.|.:|     
Yeast    70 DLQNREEFISC------YNRQ--------TQNPYWVLEHITPESLAARNAD---RKNSFFKEDEV 117

  Fly   185 ---AFKCIYGDDQSYLQNANYLVINRGHMVASADFLFTDQ-MGSTFRYLNVVPQF-KSINDGNWE 244
               .|:   |..:.|.::.    .:|||...:||..|:.| |..||...|:.||. :..|...|.
Yeast   118 IPEKFR---GKLRDYFRSG----YDRGHQAPAADAKFSQQAMDDTFYLSNMCPQVGEGFNRDYWA 175

  Fly   245 KIERWVRSQIPKSSYFRVKSGGIGILTLP-----DTRGFLQSAFLAGS--KIPVPEWTYKAV--R 300
            .:|.:.|....|....|:.:|.   |.||     |.: |..:..:.|:  .|.||...:|.:  .
Yeast   176 HLEYFCRGLTKKYKSVRIVTGP---LYLPKKDPIDNK-FRVNYEVIGNPPSIAVPTHFFKLIVAE 236

  Fly   301 DATGN------GLYVFLTYNSTFQMEK------------------------PPC--LAICYPVNC 333
            ..|.|      .:..|:..|.....|.                        ||.  .|:|..|||
Yeast   237 APTANPAREDIAVAAFVLPNEPISNETKLTDFEVPIDALERSTGLELLQKVPPSKKKALCKEVNC 301

  Fly   334 PIHLPNNPNDGYTFCCDPKRFP 355
            .|.:.:..|.......|.|..|
Yeast   302 QIVVRDFSNAAIKQSKDVKLLP 323

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 57/277 (21%)
NUC1NP_012327.1 NUC1 8..308 CDD:224777 71/331 (21%)
NUC 74..290 CDD:214683 48/244 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.