DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12917 and zgc:172339

Sequence 1:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001104647.1 Gene:zgc:172339 ZFINID:ZDB-GENE-080204-115 Length:288 Species:Danio rerio

Alignment Length:281 Identity:67/282 (24%)
Similarity:110/282 (39%) Gaps:57/282 (20%)


  Fly    63 PSGVTLLVYCSPSVFKETVCQDNGQFSVPLPMRCLSPMQPVTKHIRDGDCAGNLYAVGYTIDGKD 127
            |..|.|:.:|.|.|...:..|.:........|...:|.:.:..|.        |..:....:|| 
Zfish     3 PRAVLLVFFCFPLVNVRSEVQKDFSEECRKFMYMGTPPRGLENHY--------LKKICQRYNGK- 58

  Fly   128 LELYRTCFDCGQGRLVYS-----QSDVYYKTFFPKRPFVEFVADEMFSPQ--------EAAAYMK 179
             ..|.|.:|......|||     :||...|...|          .||.||        |..|: .
Zfish    59 -PRYVTLYDVVDHIPVYSAYTFKRSDGSKKVDVP----------WMFEPQLSTTSDSGEMQAF-P 111

  Fly   180 SNIYFAFKCIYGDDQSYLQN-ANYLVINRGHMVASADFLFTDQMGSTFRYLNVVPQFKSINDGNW 243
            .|::.:|    .|.|:.|:: :|.:...|||:.........|...:|:...|||||.:..|.|:|
Zfish   112 PNVHGSF----SDTQAVLEDYSNIVEFERGHLNPDEHQAHPDDKAATYTLTNVVPQVREFNIGHW 172

  Fly   244 EKIERWVRSQIPKSSYFRVKSGGIGILTLPDTRGFLQSAFLAGSKIPVPEWTYKAVRDATGNGLY 308
            ::.|..:|.::  ::|.|   |...|:|...|.|.:...:.. :::.||.:.:.|         |
Zfish   173 KRHEHIIRRRL--NNYCR---GTAYIVTGVTTSGRMIRRYNI-NRVAVPTYLWSA---------Y 222

  Fly   309 VFLTY--NSTF-QMEKPPCLA 326
            ..:.|  |:.| :..|.|..|
Zfish   223 CCVDYDHNAPFDERSKFPAYA 243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 54/216 (25%)
zgc:172339NP_001104647.1 Endonuclease_NS 58..268 CDD:214889 55/219 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.