DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12917 and si:dkey-85k7.11

Sequence 1:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_684184.3 Gene:si:dkey-85k7.11 ZFINID:ZDB-GENE-160728-145 Length:313 Species:Danio rerio

Alignment Length:296 Identity:54/297 (18%)
Similarity:100/297 (34%) Gaps:105/297 (35%)


  Fly    46 TYRDASGSIQLQRLETVPSGV---TLLVYCSPSVFKETVCQDNGQFSVPLPMRCLSPMQPVTKHI 107
            ::::.|   |...:.|.|||:   .|          :.:||..|           ..::..|  :
Zfish    43 SFKECS---QFFYMHTAPSGIRGGNL----------KRICQRYG-----------DKLRYAT--L 81

  Fly   108 RDGDCAGNLYAVGYTIDGKDLELYRTCFDCGQGRLVYSQSDVYYKTFFPKRPFVEFVADEMFSPQ 172
            .|..|...||: .||....|          ||.|:              ..|:       |:.||
Zfish    82 YDSSCRLALYS-AYTFKKSD----------GQRRM--------------DTPW-------MYEPQ 114

  Fly   173 EAAAYMKSNIYFAFKCI--YGDDQSYLQNANYLVIN--------RG------HMVASADFLFTDQ 221
            ..:.....|:    |.:  .|:....|:.:..::.:        ||      |...:.|      
Zfish   115 LVSPDEGGNM----KVLPSSGEIDQLLEESQAVLADYVDAVEFARGPLNPDQHQAGNQD------ 169

  Fly   222 MGSTFRYLNVVPQFKSINDGNWEKIERWVRSQIPKSSYFRVKS---GGIGILTLPDTRGFLQSAF 283
            ..:|:...|||||.....:|.|......||.::  :::.|..:   .|:.:..:...||      
Zfish   170 KAATYTLTNVVPQITEFLEGPWATYIDMVRRRL--NNFCRGTAYVVTGVTVSGMTIRRG------ 226

  Fly   284 LAGSKIPVPEWTYKAV------RDATGNGLYVFLTY 313
             ...::.||::.:.|.      |::.....::|.||
Zfish   227 -KEDRMAVPKYLWSAYCCPRFDRNSPYEVRFMFPTY 261

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 36/211 (17%)
si:dkey-85k7.11XP_684184.3 Endonuclease_NS 77..289 CDD:214889 44/239 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.