DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12917 and Sid

Sequence 1:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_651627.1 Gene:Sid FlyBaseID:FBgn0039593 Length:370 Species:Drosophila melanogaster

Alignment Length:393 Identity:109/394 (28%)
Similarity:170/394 (43%) Gaps:82/394 (21%)


  Fly     7 DCSYITLFIYIYFICFLAWEVHGDCQI------LQYM-VEQSNGIFTYRDASGSIQLQRLETVPS 64
            |..|:...:.:|   |....|..:|.|      ..|: :.|:||::         .:||.:.|..
  Fly     3 DLKYMLTILSLY---FFVGSVQANCLIDLAHLNANYVYLSQNNGVY---------DIQRSDIVEI 55

  Fly    65 GVTLLVYCSPSVFKET-VCQDNGQFSVPLPMRCLSPMQPVTKHIRDGDCA--GNLYAVGYTIDGK 126
            ..||.:.|:..:.:.| :|:.:..||..|.....:|..||...:.|..|:  ...:|||::.:|:
  Fly    56 HQTLYLLCNGGLHRTTFLCRYDSVFSPALSSAACAPPDPVVVKVPDTSCSIPSATFAVGFSFNGR 120

  Fly   127 DLELYRTCFDCGQGRLVYSQSDVY----YKTFFPKRPFVEFVADEMFSPQEAAAYMKSNIYFAFK 187
            .:||||.|||   |..:..|..:|    |....| ||...:.:|::..                 
  Fly   121 FMELYRNCFD---GYSLAFQHSIYKAYRYVNTVP-RPNPTWQSDQLSG----------------- 164

  Fly   188 CIYGDDQSYLQNANYLVI-------------NRGHMVASADFLFTDQMGSTFRYLNVVPQFKSIN 239
               |.|.:|...|....:             :||||..::.|:.|:...|||||||.:||::.:|
  Fly   165 ---GFDNAYEGRATQACLLTNLGAVQPQCKFDRGHMTPASAFISTELKKSTFRYLNAIPQYRGVN 226

  Fly   240 DGNWEKIERWVRS--------------QIPKS-SYFRVKSGGIGI--LTLPDTRGFLQSAFLAGS 287
            .|.|:.:|.||.:              |||:: ...:|..|.:|:  |........:....|..:
  Fly   227 RGKWKAVETWVNNMVRGLYDNPIINNVQIPRTYDVLKVCIGALGVHRLRHNTNNNMIPIYLLDNN 291

  Fly   288 KIPVPEWTYKAVRDATGNGLYVFLTYNSTFQMEKPPCLAICYPVNCPIHLPNNPND-GYTFCCDP 351
            |||||||.||.|...:|: .:|.||||......:.....||:.:.|...|..|..| |:|.||||
  Fly   292 KIPVPEWMYKIVSHLSGD-KWVMLTYNDVSLPNQQALNQICHVIPCHPGLNLNTKDVGHTVCCDP 355

  Fly   352 KRF 354
            .||
  Fly   356 YRF 358

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 76/259 (29%)
SidNP_651627.1 Endonuclease_NS 106..358 CDD:279553 81/277 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131073171
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D933605at2759
OrthoFinder 1 1.000 FOG0005351
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13966
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.