DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12917 and CG14062

Sequence 1:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001034074.1 Gene:CG14062 FlyBaseID:FBgn0039592 Length:346 Species:Drosophila melanogaster

Alignment Length:347 Identity:134/348 (39%)
Similarity:208/348 (60%) Gaps:7/348 (2%)


  Fly    11 ITLFIYIYFICFLAWEVHGDCQILQYMVEQSNGIFTYRDASGSIQLQRLETVPSGVTLLVYCSPS 75
            :.:.:.:...|.||   ||.|:..:..|:.:|.||..|..:..:.|:|..:...|.||.::|:|.
  Fly     2 LRILLLLLAFCALA---HGQCRFTRAQVQGTNRIFMVRGQNRQLSLKRTASSAVGETLQMWCNPR 63

  Fly    76 VFKETVCQDN--GQFSVPLPMRCLSPMQPVTKHIRDGDCAGNLYAVGYTI-DGKDLELYRTCFDC 137
            ....|.||..  ..|..||||.|.:....:|..::|..|...:|.|||.: :.:.|||||.|||.
  Fly    64 DIVATTCQAGRVPAFQPPLPMTCRAAPAAITTPVQDRRCPATMYRVGYNVGNNQFLELYRACFDT 128

  Fly   138 GQGRLVYSQSDVYYKTFFPKRPFVEFVADEMFSPQEAAAYMKSNIYFAFKCIYGDDQSYLQNANY 202
            ...|.::.:..||.|.|:..||.|:|.:|.:.|..:.|:|...||:..|:.::|::|:|:.|...
  Fly   129 RAVRAIFVEHRVYGKPFYITRPCVQFSSDGVISGADEASYTVRNIHGTFRRLFGNNQNYIPNNRD 193

  Fly   203 LVINRGHMVASADFLFTDQMGSTFRYLNVVPQFKSINDGNWEKIERWVRSQIPKSSYFRVKSGGI 267
            ::|||||:.|||||.|.||:.:||:|:|.|||||||||||||.|||:||:.:..:::..|::|..
  Fly   194 VIINRGHLAASADFFFGDQLCATFKYVNAVPQFKSINDGNWETIERFVRNSVTGNNFVNVRTGAR 258

  Fly   268 GILTLPDTRGFLQSAFLAGSKIPVPEWTYKAVRDATGNGLYVFLTYNSTFQMEKPPCLAICYPVN 332
            |:|:|| :....::.||:|::.|||:|.||.||:|....:..|||.|:.:..::|.....|.|||
  Fly   259 GVLSLP-SGNRPKNVFLSGNRNPVPQWMYKIVRNANNQPIVAFLTLNNIYARQRPAAPNFCQPVN 322

  Fly   333 CPIHLPNNPNDGYTFCCDPKRF 354
            ||:.|.|....|::|||:|..|
  Fly   323 CPVALVNTAQAGFSFCCNPATF 344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 98/224 (44%)
CG14062NP_001034074.1 Endonuclease_NS 102..344 CDD:279553 104/243 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131073059
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D933605at2759
OrthoFinder 1 1.000 FOG0005351
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13966
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.