DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12917 and Tengl4

Sequence 1:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_650038.2 Gene:Tengl4 FlyBaseID:FBgn0037857 Length:378 Species:Drosophila melanogaster

Alignment Length:137 Identity:27/138 (20%)
Similarity:54/138 (39%) Gaps:28/138 (20%)


  Fly   188 CIYGDDQSYLQNAN-YLVINRGHMVASA---DFLFTDQMG-----------------STFRYLNV 231
            |:...|:..|...| |:..|....:.||   ||..:|.:|                 ..:::.|:
  Fly   175 CVQERDEKTLNKPNAYITDNTIPTIFSANMRDFKNSDWVGGHLASPQNYKCDALKFLEAYKFTNI 239

  Fly   232 VPQFKSINDGNWEKIERWVRSQIPKSSYFRVKSGGIGILTLPDTRGF----LQSAFLAGSKIPVP 292
            ||..:.:.:..|.::|.:||.:..:.....|.:|.   |.:|....|    ::...:..:.:.||
  Fly   240 VPINRGLKNHIWYRLESYVRDKAIEFDSVHVYTGP---LFMPQRITFRNWSVRYHVMGMNTVAVP 301

  Fly   293 EWTYKAV 299
            ...:|.:
  Fly   302 THFFKII 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 27/138 (20%)
Tengl4NP_650038.2 Endonuclease_NS 132..362 CDD:279553 27/138 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2222648
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D933605at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13966
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.