DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12917 and CG6839

Sequence 1:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_649076.1 Gene:CG6839 FlyBaseID:FBgn0036831 Length:430 Species:Drosophila melanogaster

Alignment Length:369 Identity:82/370 (22%)
Similarity:150/370 (41%) Gaps:78/370 (21%)


  Fly    36 YMVEQSNGIFTYRD-------ASGSIQL----------QRLETVP--SGVTLLVYCSPSVFKETV 81
            |:...|...:.:.|       :.||:||          :.|.|..  ||.|..|..|...||:..
  Fly    72 YLKTDSEDFYPFSDVGVMEFESGGSLQLWCPSGFNTHSENLLTASCVSGTTFSVGGSNFEFKDLY 136

  Fly    82 CQDNGQFSVPLPMRCLSPMQPVTKHIRDG-DCAGNL-YAVGYTI-DGKDLELYRTCFDCGQGRLV 143
            |:.                .|..|.::.| .|.|.: ..||:.| ..:..|..:.||:..:....
  Fly   137 CKS----------------WPGFKAVKSGATCNGGIVIRVGFEITSSRFAEQMQICFNEEEEVTR 185

  Fly   144 YSQSDV-----YYKT-----------FFPKRPFVEFVADEMFSPQEAAAYMKSNIYFAFKCIYGD 192
            |::..:     ||:|           ||..:.     .|::::.......:.:.       :.||
  Fly   186 YTRHKLEPGSNYYETGVARITFQTAGFFDGKN-----VDKLYTQATQLETINNE-------LGGD 238

  Fly   193 DQSYLQNANYLVINRGHMVASADFLFTDQMGSTFRYLNVVPQFKSINDGNWEKIERWVRSQIPKS 257
            .:.|..:::.:.:.|||:.|.|||.:..:..:||.::|..||:::.|.|||.::|..:|:.:.|:
  Fly   239 AEKYFDSSSNVYLARGHLGAKADFDYAPEQRATFLFINAAPQWQTFNAGNWARVEDGLRAWVSKN 303

  Fly   258 SY-FRVKSGGIGILTLPDTRGFLQSAFLA-----GSKIPVPEWTYKAVRDATGNGLYVFLTYNST 316
            .. ....:|..|:.|||:..|.....:||     ...||||:..::.|.|.:.:...||:..|:.
  Fly   304 KLNVNCYTGVYGVTTLPNKDGVETPLYLAKDDNNNGLIPVPKLYFRVVIDPSSHRGIVFVGVNNP 368

  Fly   317 FQMEK--PPCLAICYPVNCPIHLPN----NPNDGYTFCCDPKRF 354
            ...|:  .....||..|:..:...|    :...|:::.|:...|
  Fly   369 HLTEEQIKRDYVICDDVSDQVTYINWKTTDIKAGWSYACEVADF 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 56/252 (22%)
CG6839NP_649076.1 NUC 170..420 CDD:238043 57/256 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2215599
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005351
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13966
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.