DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12917 and Endog

Sequence 1:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001030110.1 Gene:Endog RGDID:1310763 Length:294 Species:Rattus norvegicus

Alignment Length:153 Identity:36/154 (23%)
Similarity:65/154 (42%) Gaps:22/154 (14%)


  Fly   188 CIYGDDQSY-----LQNANY--LVINRGHMVASADFLFTDQ-MGSTFRYLNVVPQFKSINDGNWE 244
            |.:.:|.|.     ..||:|  ...:|||:.|:|:..::.: |..||...||.||...:|...|.
  Rat   110 CDFHEDDSVHAYHRATNADYRGSGFDRGHLAAAANHRWSQRAMDDTFYLSNVAPQVPHLNQHAWN 174

  Fly   245 KIERWVRSQIPKSSYFRVKSGGIGILTLP----DTRGFLQSAFLAGSKIPVPEWTYKAVRDATGN 305
            .:|::.||.........|.:|.   |.||    |.:.:::...:..:.:.||...:|.:.....:
  Rat   175 NLEKYSRSLTRTYQNVYVCTGP---LFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEAAS 236

  Fly   306 GLYVFLTY-------NSTFQMEK 321
            |.....:|       :.|..:|:
  Rat   237 GQIELRSYVMPNAPVDETLPLER 259

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 36/154 (23%)
EndogNP_001030110.1 NUC 75..281 CDD:214683 36/154 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13966
Phylome 1 0.910 0.750 Consistency score
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.