DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12917 and Tengl2

Sequence 1:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_722779.1 Gene:Tengl2 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster

Alignment Length:158 Identity:33/159 (21%)
Similarity:58/159 (36%) Gaps:39/159 (25%)


  Fly   206 NRGHMVASAD-FLFTDQMGSTFRYLNVVPQF-KSINDGNWEKIERWVRSQIPKSSYFRVKSGGIG 268
            :|||:.|:.: .|..:....||...|:.||. :..|...|..:|::||:.:.       :.|.:.
  Fly   150 DRGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGFNRSAWNNLEQYVRNLVH-------RFGSVF 207

  Fly   269 ILT--------LPDTRGFLQSAFLAGSKIPVPEWTYKAVRDATGNGLYVFLTYNSTFQMEKPPCL 325
            :.|        .|..:..::...:..:.:.||...:|.:            ...|...:.||...
  Fly   208 VCTGPLYKPNQRPGGKWAVEYEMIGLNMVAVPTHFFKVI------------MVESKLHLGKPYME 260

  Fly   326 AICYPVNCPIHLPNNPNDGY---TFCCD 350
            ....| |.||      .||.   :|.||
  Fly   261 GYVLP-NAPI------PDGLPLRSFLCD 281

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 33/159 (21%)
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 33/159 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2222636
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D933605at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13966
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.