DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12917 and Exog

DIOPT Version :9

Sequence 1:NP_610558.2 Gene:CG12917 / 36065 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_006244150.2 Gene:Exog / 301062 RGDID:1304628 Length:443 Species:Rattus norvegicus


Alignment Length:99 Identity:30/99 - (30%)
Similarity:44/99 - (44%) Gaps:8/99 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 NRGHMVASADFLFTDQ-MGSTFRYLNVVPQFKSINDGNWEKIERWVRSQIPKSSYFRVKSGGIGI 269
            :||||..:.:..|:.: |..||...|:|||....|.|.|.:||.:.|....:.....:.||.   
  Rat   212 SRGHMAPAGNNKFSSEAMAETFYLSNIVPQNFENNSGYWNRIEMYCRELTERFEDVWIVSGP--- 273

  Fly   270 LTLPDTRG----FLQSAFLAGSKIPVPEWTYKAV 299
            ||||.||.    .:....:....:.||...||.:
  Rat   274 LTLPHTRNDGTKTVSYQVIGEDNVAVPSHLYKVI 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 30/99 (30%)
ExogXP_006244150.2 NUC 152..361 CDD:214683 30/99 (30%)
Exog_C 377..425 CDD:407864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341980
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.