DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12917 and Exog

Sequence 1:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_006244150.1 Gene:Exog RGDID:1304628 Length:392 Species:Rattus norvegicus

Alignment Length:99 Identity:30/100 (30%)
Similarity:44/100 (44%) Gaps:8/100 (8%)


  Fly   206 NRGHMVASADFLFTDQ-MGSTFRYLNVVPQFKSINDGNWEKIERWVRSQIPKSSYFRVKSGGIGI 269
            :||||..:.:..|:.: |..||...|:|||....|.|.|.:||.:.|....:.....:.||.   
  Rat   161 SRGHMAPAGNNKFSSEAMAETFYLSNIVPQNFENNSGYWNRIEMYCRELTERFEDVWIVSGP--- 222

  Fly   270 LTLPDTRG----FLQSAFLAGSKIPVPEWTYKAV 299
            ||||.||.    .:....:....:.||...||.:
  Rat   223 LTLPHTRNDGTKTVSYQVIGEDNVAVPSHLYKVI 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 30/100 (30%)
ExogXP_006244150.1 NUC 101..310 CDD:214683 30/100 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2221636
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.