DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12917 and CG33346

Sequence 1:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_996301.2 Gene:CG33346 FlyBaseID:FBgn0053346 Length:364 Species:Drosophila melanogaster

Alignment Length:362 Identity:117/363 (32%)
Similarity:178/363 (49%) Gaps:25/363 (7%)


  Fly     1 MKIAPMDCSYITLFIYIYFICFLAWEVHGDCQILQYMVEQSNGIFTYRDASGSIQLQRLETVPSG 65
            ||:..:....|||.:::     ....|...|||.| ....::.:|.:      |...|.|.:.:.
  Fly     1 MKMHELRYLIITLSLFL-----TVGNVKSFCQITQ-AETWTDRLFVH------IVNNRYELLLTD 53

  Fly    66 -------VTLLVYCSPSVFKETVCQDNGQFSVPLP-MRCLSPMQPVTKHIRDGDCAGNLYAVGYT 122
                   ::||...:..||..| |::|||||.||| ..|...:.|.........|...:|.||:.
  Fly    54 QLQPNQQISLLCDGNAQVFTST-CRNNGQFSPPLPRTNCSKAIPPSVVPTSSNICPHTMYLVGFK 117

  Fly   123 IDGKDLELYRTCFDCGQGRLVYSQSDVYYKTFFPKRPFVEFVADEMFSPQEAAAYMKSNIYFAFK 187
            .....:||||:|:|....:..:|.:.||.......||...|..|.:.:|.:.|.:..::||..|:
  Fly   118 YGNTFMELYRSCYDARTMKAYFSINTVYPTNLKSDRPPTVFDKDGIITPADEATFQMNSIYNRFE 182

  Fly   188 CIYGDDQSYLQNANYLVINRGHMVASADFLFTDQMGSTFRYLNVVPQFKSINDGNWEKIERWVRS 252
            .::|..|:|:.::..|..:|||:...||:.|...:..|.:|||||||:.:||..||:.:|.|||.
  Fly   183 YLFGSGQTYVPSSRSLSFDRGHLTPVADYSFPKILRQTNKYLNVVPQYYNINRSNWKIVENWVRG 247

  Fly   253 QIPKSSYFRVKSGGIGILTLPDTRGFLQSAFLAGSKIPVPEWTYKAVRDATGNGLYVFLTYNSTF 317
            |   .....|.:|.:|:|.|.:......|.:||.:|.|||.||||.:|..|....||.||.|:.:
  Fly   248 Q---KDVLNVCTGALGVLDLLNRSQKSVSIYLAPNKNPVPRWTYKIIRSLTTGIKYVILTSNNGW 309

  Fly   318 QMEKPPCLAICYPVNCPIHLPNNPNDGYTFCCDPKRF 354
            :.::|...::|....||..| |....||||||||..|
  Fly   310 ETQQPNPASVCKVTACPRTL-NPTGTGYTFCCDPIDF 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 82/224 (37%)
CG33346NP_996301.2 Endonuclease_NS 124..344 CDD:214889 82/224 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131073115
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D933605at2759
OrthoFinder 1 1.000 FOG0005351
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13966
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.