DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12917 and cps-6

Sequence 1:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_491371.1 Gene:cps-6 WormBaseID:WBGene00000787 Length:308 Species:Caenorhabditis elegans

Alignment Length:128 Identity:34/129 (26%)
Similarity:53/129 (41%) Gaps:26/129 (20%)


  Fly   188 CIYGDD----QSYL-QNANYLV--INRGHMVASADF----LFTDQMGSTFRYLNVVPQF-KSIND 240
            |.:..|    |.:| ||.:|..  .:|||:.|:.:.    |..||   ||...|:.||. :..|.
 Worm   120 CEFKPDITFPQKFLSQNTDYKCSGFDRGHLAAAGNHRKSQLAVDQ---TFYLSNMSPQVGRGFNR 181

  Fly   241 GNWEKIERWVRSQIPK--SSYFRVKSGGIGILTLP----DTRGFLQSAFLAGSKIPVPEWTYK 297
            ..|..:|...|....|  :||...     |.|.||    |.:.:::...:..:.:.||...:|
 Worm   182 DKWNDLEMHCRRVAKKMINSYIIT-----GPLYLPKLEGDGKKYIKYQVIGDNNVAVPTHFFK 239

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 34/129 (26%)
cps-6NP_491371.1 NUC1 10..308 CDD:224777 34/129 (26%)
NUC 83..293 CDD:214683 34/129 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.