DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12917 and Endog

Sequence 1:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_031957.1 Gene:Endog MGIID:1261433 Length:294 Species:Mus musculus

Alignment Length:130 Identity:35/131 (27%)
Similarity:59/131 (45%) Gaps:16/131 (12%)


  Fly   188 CIYGDDQSY-----LQNANY--LVINRGHMVASADFLFTDQ-MGSTFRYLNVVPQFKSINDGNWE 244
            |.:.:|.|.     ..||:|  ...:|||:.|:|:..::.: |..||...||.||...:|...|.
Mouse   110 CDFREDDSVHAYHRATNADYRGSGFDRGHLAAAANHRWSQRAMDDTFYLSNVAPQVPHLNQNAWN 174

  Fly   245 KIERWVRSQIPKSSYFRVKSGGIGILTLP----DTRGFLQSAFLAGSKIPVPEWTYKA-VRDATG 304
            .:||:.||.........|.:|.   |.||    |.:.:::...:..:.:.||...:|. :.:|.|
Mouse   175 NLERYSRSLTRTYQNVYVCTGP---LFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEAAG 236

  Fly   305  304
            Mouse   237  236

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 35/131 (27%)
EndogNP_031957.1 NUC1 29..278 CDD:224777 35/131 (27%)
NUC 75..281 CDD:214683 35/131 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13966
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.