DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12917 and LOC105946862

Sequence 1:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_017948166.1 Gene:LOC105946862 ID: Length:296 Species:Xenopus tropicalis

Alignment Length:345 Identity:66/346 (19%)
Similarity:116/346 (34%) Gaps:117/346 (34%)


  Fly    20 IC--FLAWEVHGDCQILQYMVEQSNGIFTYRDASGSIQLQRLETVPSGVTLLVYCSPSVFKET-- 80
            :|  |||:....:..|:....|.:|  |.|::.                      .|..|::|  
 Frog     7 LCWLFLAFPHMAETHIVDNFNECNN--FFYKNK----------------------PPVGFQDTAK 47

  Fly    81 ----VCQ---DNGQFSVPLPMRCLSPMQPVTKHIRDGDCAGNLYAVGYTIDGKDLELYRTCFDCG 138
                :||   |...|:.                :.|.|....|:: .|.:|.|.|        ..
 Frog    48 NKAYICQMYKDTTYFAT----------------LYDRDRRIPLFS-AYKMDKKSL--------LN 87

  Fly   139 QGRLVYSQS------------DVYYKTFFPKRPFVEFVADEMFSPQEAAAYMKSNIYFAFKCIYG 191
            |.:|..:||            |:..|:...:...|:.:.:  ::.:::.....||:.        
 Frog    88 QKKLKTNQSPEFNVEPQLVYRDLPKKSMLSETETVDSITE--YNMKKSKRKNASNLL-------- 142

  Fly   192 DDQSYLQNANYLVIN--RGHMVASADFLFTDQMGSTFRYLNVVPQFKSINDGNWEKIERWVRSQI 254
             :.|...||:|...|  |||:.........|...:|....|||||.|.:|...|:|.|..: :.|
 Frog   143 -EMSQAVNADYRESNYTRGHLNPKGHHGKGDGQEATCTLTNVVPQTKKLNGEIWKKYETEM-TDI 205

  Fly   255 PKSSYFRVKSGGIGILTLPDTRGFLQSAFLAGS-------KIPVPEWTY-----KAVRDATGNGL 307
            .|:.                |..|:.:..:.|:       .||...|:.     |..:..:|..|
 Frog   206 AKTC----------------TEMFVVTGIVPGNNRLNARVNIPSHVWSAYCCIGKKGKPTSGAAL 254

  Fly   308 YVFLTYNSTFQMEKPPCLAI 327
               .:.:.|..:|..|.:.:
 Frog   255 ---ASVDETIPLEHKPVMEL 271

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 43/226 (19%)
LOC105946862XP_017948166.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.