DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12917 and LOC105945145

DIOPT Version :9

Sequence 1:NP_610558.2 Gene:CG12917 / 36065 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_017948005.1 Gene:LOC105945145 / 105945145 -ID:- Length:332 Species:Xenopus tropicalis


Alignment Length:254 Identity:53/254 - (20%)
Similarity:88/254 - (34%) Gaps:67/254 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 VPSGVTLLVYCSPSVFKETVCQ------------DNGQFSVPLPMRCLSPMQPVTKHIRDGDCAG 114
            :|.|:......||:.    :||            |.|: .|||....:...:|.:|.|.......
 Frog    56 LPDGIKAKELTSPAY----ICQKYGNRVYFASLYDRGR-RVPLYSAYILDRRPTSKPINKRQTFF 115

  Fly   115 NLYAVGYTIDGKDLELYRTCFDCGQGRLVYSQSDVYYKTFFPKR----PFVEFVADEMFSPQEAA 175
            |:                      :.:|:|.|.|   .|..|:|    ....|......||:|  
 Frog   116 NI----------------------EPQLIYRQLD---GTMLPERNTSNNIKTFNTKHNISPRE-- 153

  Fly   176 AYMKSNIYFAFKCIYGDDQSYLQNANYLVINRGHMVASADFLFTDQMGSTFRYLNVVPQFKSIND 240
              .|:............|..| :|:.|   :|||:......:..|:...||...||||..|.:|:
 Frog   154 --QKNQPSSLINTSQAVDADY-RNSGY---DRGHVNPRGHHVTDDEQKGTFTLTNVVPMAKKLNN 212

  Fly   241 GNWEKIERWVRSQIPKSSYFRVKSGGIGILTLPDTRGFLQS-AFLAGSKIPVPEWTYKA 298
            ..|.:.|   ...|..:.         |..|:....|.:.| .::.|.::.:|::.:.|
 Frog   213 EFWSQYE---NDMIGSAK---------GCKTMYVVTGIVPSKEWIKGDRVNIPKYMWNA 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 38/175 (22%)
LOC105945145XP_017948005.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.