DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12917 and wu:fd46g04

Sequence 1:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_009291437.1 Gene:wu:fd46g04 ZFINID:ZDB-GENE-030131-4651 Length:272 Species:Danio rerio

Alignment Length:319 Identity:60/320 (19%)
Similarity:111/320 (35%) Gaps:99/320 (31%)


  Fly    15 IYIYFICFLAWEVHGD-CQILQYMVEQSNGIFTYRDASGSIQLQRLETVPSGVTLLVYCSPSVFK 78
            :::....|...||..| .|..||.::.:..:|               ..|:||::          
Zfish     5 VFLLLPLFTLSEVLNDFTQCSQYFLDDTAPVF---------------KAPTGVSV---------- 44

  Fly    79 ETVCQ------DNGQFSVPLPMRCLSPMQPVTKHIRDGDCAGNLYAVGYTIDGKDLELYRTCFDC 137
            :.:||      ||.:|                           |||..|:...| :.:|...:  
Zfish    45 KHICQCLWDEDDNKKF---------------------------LYATLYSTTWK-IPIYSAYW-- 79

  Fly   138 GQGRLVYSQSDVYYKTFFPKRPFVEFVADEMFSP--QEAAAYMKSNIYFAFKCIYGDDQSYLQNA 200
             .|:....:.||:|         :|...|....|  :...:.:|:|     :.:..|    .:|:
Zfish    80 -FGKESTGRCDVWY---------IEPQLDGENEPCMRPKGSKIKNN-----QAVSSD----YKNS 125

  Fly   201 NYLVINRGHMVASADFLFTDQMGSTFRYLNVVPQFKSINDGNWEKIERWVRSQIPKSSYFRVKSG 265
            .|   ::||:...........|.:|....|..||....|..:|::.|:.|...:.......|.:|
Zfish   126 GY---DKGHVYPVMHTYNHLAMLATSTLTNAAPQKSKFNKEDWKEHEKAVIKDLASCKKAYVVAG 187

  Fly   266 GIGILTLPDTRGFLQSAFLAGSKIPVPEWTYKAVRDATGNGLYVFLTY---NSTFQMEK 321
                 ..|||     :|....:||.|.::.::|......|.:|:...|   |:..::|:
Zfish   188 -----VAPDT-----TAAKVNNKITVSKFFWRATCCLNSNDVYIGKAYFGPNNNDKVEE 236

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 39/199 (20%)
wu:fd46g04XP_009291437.1 Endonuclease_NS 62..260 CDD:214889 43/211 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.