DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12917 and LOC101886621

Sequence 1:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_017210191.1 Gene:LOC101886621 ID: Length:298 Species:Danio rerio

Alignment Length:232 Identity:40/233 (17%)
Similarity:75/233 (32%) Gaps:96/233 (41%)


  Fly   161 VEFVADEMFSPQEAAAYMKSNIYFAFKCIYGDD----------QSYLQNAN---------YLVIN 206
            ::....|:|..:..:...|..:..|:|.|  |:          :||:.:.|         |.::|
Zfish    19 IKIPLSELFGSEATSEPPKLTVPSAYKLI--DECPSKKKIRTKKSYVMSYNENTKNAEWVYEILN 81

  Fly   207 ------------------------RGHMVASADFLFTDQ-MGSTFRYLNVVPQFKSINDGNWEKI 246
                                    |||:.|:::..:..: ...||.:.|:.||...:|......:
Zfish    82 KDTLAKKDIAKGKFSDYSKVAGYTRGHLAAASNHGWCQEAYDETFLFSNISPQCAELNKHMMNAL 146

  Fly   247 ERWVR------------------------------SQIPKSSYFRV---------KSGGIGILTL 272
            |:|.:                              .::...|:|:|         .|..||.|..
Zfish   147 EKWCQETVTDQILNVHVYTGPIITANSAIQRRNASEKVVPDSFFKVIIKENRNGTVSEPIGYLIT 211

  Fly   273 PDTRGFLQSAFLAGSKI----PVPEWTY----KAVRD 301
            .|....::.   |..|:    |:.|:..    |:|||
Zfish   212 NDETTLVKD---AEDKVKHAMPIDEFVQTKYKKSVRD 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 40/233 (17%)
LOC101886621XP_017210191.1 Endonuclease_NS 51..255 CDD:307400 33/199 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.