DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12917 and LOC101885869

DIOPT Version :9

Sequence 1:NP_610558.2 Gene:CG12917 / 36065 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_005159398.1 Gene:LOC101885869 / 101885869 -ID:- Length:368 Species:Danio rerio


Alignment Length:308 Identity:71/308 - (23%)
Similarity:112/308 - (36%) Gaps:103/308 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SNGIFTYRDASGSIQLQRLETVPSGVTLLVY---------------CS-----------PSVFKE 79
            ::.:|...|   |:||:...:|.|  .|||:               ||           |.:.|:
Zfish    79 TSALFLTHD---SLQLKMRRSVVS--ALLVFSFPFIITEVVDSFSKCSQFFLEGKPPVIPGILKD 138

  Fly    80 TVCQDNGQFSVPLPMRCLSPMQPVTKHIRDGDCAGNLYAVGYTIDGKDLELYRTCFDCGQGRLVY 144
            :|.|||.::                          .|....|    |:...:.|.:|......|:
Zfish   139 SVSQDNNRY--------------------------KLICQRY----KNAYRFATLYDTTNKIPVF 173

  Fly   145 SQSDVYYKTFFPK-RPFVEFVADEMFSPQEAAAYMKSNIYFAFKCIYGDDQSYLQNANYLV-INR 207
            |   .|..|.|.| ||.:.:    |..||    ...|.:....:.:   :|:|.::...|. ::|
Zfish   174 S---AYRYTGFKKGRPQIRW----MIEPQ----LETSGVQMRARRV---NQAYTEDYQKLYRLDR 224

  Fly   208 GHMVASADFLFTDQMGSTFRYLNVVPQFKSINDGNWEKIERWVR----SQIPKSSYFRVKSGGIG 268
            ||:..:......|...|||...|||||:||.|.|:|.::|..||    |...|:....|.:|.: 
Zfish   225 GHLFPNGHAANKDIAESTFTLTNVVPQYKSFNGGSWNRMENDVRELMDSDCAKNRPAYVLTGAV- 288

  Fly   269 ILTLPDTRGFLQSAFLAGSKIPVPEWTYKAVRDATGNGLYVFLTYNST 316
                |:...:|      ..|:.:|...:.|           |..||.|
Zfish   289 ----PNQEHYL------NQKVNIPTHMWNA-----------FCCYNKT 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 50/194 (26%)
LOC101885869XP_005159398.1 Endonuclease_NS 158..328 CDD:214889 50/194 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12511
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.