DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12917 and LOC100487990

Sequence 1:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_002932825.1 Gene:LOC100487990 ID: Length:306 Species:Xenopus tropicalis

Alignment Length:258 Identity:57/259 (22%)
Similarity:96/259 (37%) Gaps:45/259 (17%)


  Fly    85 NGQFSVPLPMRCLSPMQPVTKHIRDGDCAGNLYAVGYTIDG-KDLELYRTCFDCGQGRLVYSQ-- 146
            :|...:.||.....|..|      ||....||.:..|.... |:.:.:.:.:|.|:...:||.  
 Frog    40 DGFDDIALPHHINHPNLP------DGIKERNLASPAYICQQYKNDDRFASLYDRGRRVPLYSAYI 98

  Fly   147 ---------SDVYYKTFFPKRPFVEFVADEMFSPQEAAAYMKSNIYFAFKCIYGDDQ----SYLQ 198
                     ||  .|..|...|.:...|......:|:|...:..|:|..|.|....:    |...
 Frog    99 LDRRSASNCSD--RKNTFDVEPQLVDRALNKAMLRESATTREIQIHFKLKNIQEAQERLRTSQAV 161

  Fly   199 NANYLV--INRGHMVASADFLFTDQMGSTFRYLNVVPQFKSINDGNWEKIERWVRSQIPKSSYFR 261
            ||:|.:  .:|||:.........|...:||...|.||...|:|.|.|...|:.:.::....:...
 Frog   162 NADYGIAGFHRGHLNPVCHHEDKDAQDATFTLTNAVPMDSSLNQGQWRIYEKQMIAKARDCNTMY 226

  Fly   262 VKSGGIGILTLPDTRGFLQSAFLAGSKIPVPE--WT-YKAVRD-----ATGNGLYVFLTYNST 316
            |.:|     .:|...      ::...::.:|.  |: |..|.:     .:|.||...:.|:.|
 Frog   227 VVTG-----IVPGNN------WIKNDRVNIPSQVWSAYCCVGNNDKPIGSGAGLANNINYSVT 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 46/214 (21%)
LOC100487990XP_002932825.1 Endonuclease_NS 79..294 CDD:214889 46/214 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.