DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12917 and exog

Sequence 1:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_004915758.1 Gene:exog XenbaseID:XB-GENE-981839 Length:226 Species:Xenopus tropicalis

Alignment Length:52 Identity:11/53 (21%)
Similarity:16/53 (30%) Gaps:13/53 (25%)


  Fly   284 LAGSKIPVPEWTYKAVRDATGNGLYVFLTYNSTFQMEKPPCLAICYPVNCPI 335
            :....:.||...||.:. ..|.|            .|:|..:......|.||
 Frog    77 IGADDVSVPSHLYKVIL-VRGKG------------SEQPLAVGAFVVPNSPI 115

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 11/53 (21%)
exogXP_004915758.1 NUC <75..146 CDD:294067 11/53 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2221129
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.