DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12917 and LOC100145419

Sequence 1:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001120352.1 Gene:LOC100145419 XenbaseID:XB-GENE-5856158 Length:285 Species:Xenopus tropicalis

Alignment Length:226 Identity:43/227 (19%)
Similarity:78/227 (34%) Gaps:71/227 (31%)


  Fly   111 DCAGNLYA----VGYTIDGKDLELYRTCFDCGQGRLVYSQSDVYYKTFFPK-------------- 157
            ||.|..||    ||:  |....::...|      ::..:.::.::.:.:.|              
 Frog    25 DCRGQFYASAPPVGF--DSLSSQITPIC------QMYETNNNPFFASLYHKVNHYPLYSAYILDT 81

  Fly   158 RPFVEFVADEMF--SPQEAAAYMKSNIYFAFKCIYGDDQSYLQ------------------NANY 202
            ||.....:|:.|  .||.....:...|     .:..|.:|.::                  |::|
 Frog    82 RPGDTTGSDQTFRLEPQLVDTRLPRQI-----MLQPDTESAIRSLGFTGTAADHIKKVQAINSDY 141

  Fly   203 LVIN--RGHMVASADFLFTDQMGSTFRYLNVVPQFKSINDGNWEKIERWVRS------------- 252
            ...|  :||:..:||.........|:...||.|....:|.|.|...|..||:             
 Frog   142 TGSNYHKGHLNPNADHPAGAGQLVTYTLTNVAPMHGPLNSGAWRNNEMRVRNIAAGCGKMHVITG 206

  Fly   253 QIPKSSYFRVKSGGIGILTLPDTRGFLQSAF 283
            .:|.:::..|  .|:..:.:|   ..:.|||
 Frog   207 VVPGNNWISV--NGVQRVNIP---SHVWSAF 232

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 35/205 (17%)
LOC100145419NP_001120352.1 Endonuclease_NS 61..261 CDD:214889 34/183 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.