DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12917 and LOC100002544

Sequence 1:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_001920405.3 Gene:LOC100002544 ID: Length:336 Species:Danio rerio

Alignment Length:287 Identity:65/288 (23%)
Similarity:105/288 (36%) Gaps:75/288 (26%)


  Fly    78 KETVCQDNGQFSVPLPMRCLSPM---QPVT----------------KHIRDGDCAGNLYAVGYTI 123
            |||:..|..:  .|||...||.:   ..||                .||.  .|..:|| :|...
Zfish    18 KETLEPDFRE--APLPKMQLSNLLLALAVTMWFSEHWGTAIVVEDFNHIE--RCKDSLY-MGTPP 77

  Fly   124 DG-KDLELYRTCFDCGQGRLVYSQSDVYYKTFFPK--------RPFVEFVADE------MFSPQE 173
            .| ||..|.:.|       ..|:....:...:.||        ..|.:...|.      |:.||.
Zfish    78 RGFKDPSLKKIC-------QRYADKPRFVTLYDPKIRIPVYSAYSFKKTEGDRRVDYPWMYEPQL 135

  Fly   174 AAAYMKSNI------YFAFKCIYGDDQSYLQNANYLVI-NRGHMVASADFLFTDQMGSTFRYLNV 231
            |......|:      |...|  :.|.|:.|.:.:.:|: .|||:.............:|:...||
Zfish   136 AEIDGNGNMMPFPTGYLHMK--FEDSQAVLDDYSDVVLYERGHLNPDQHQSDPQDRAATYTLTNV 198

  Fly   232 VPQFKSINDGNWEKIERWVRSQIPKSSYFRVKSGGIGILTLPDTRGFLQSAFLAG----SKIPVP 292
            ||:.:..|.|.|.:.|..:|.::  :::.|   |...|:|     |.:.:..:..    :::.:|
Zfish   199 VPEIREFNIGPWRQYEERIRVRL--NNFCR---GTAYIVT-----GVIHAGNMIRRNNLNRVGIP 253

  Fly   293 E--WTYKAVRDATGNGLYV----FLTY 313
            |  |:.....|...|..:|    |.||
Zfish   254 EDVWSAYCCTDYDRNSPHVERIHFPTY 280

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 45/217 (21%)
LOC100002544XP_001920405.3 Endonuclease_NS 95..>273 CDD:214889 39/190 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.