DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12917 and endog

Sequence 1:NP_610558.2 Gene:CG12917 FlyBaseID:FBgn0033490 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001019385.1 Gene:endog ZFINID:ZDB-GENE-050522-402 Length:306 Species:Danio rerio

Alignment Length:224 Identity:54/225 (24%)
Similarity:90/225 (40%) Gaps:41/225 (18%)


  Fly    90 VPLP----MRCLSPMQPVTKHIRDGDCAGNLYAVGYTIDGKDLELYRTCFDCGQGRL---VYSQS 147
            :|:|    ...:||.||....: :...|...|......:.|..|.|.|.:| .:.|.   |..|.
Zfish    48 IPIPSVDAASEISPYQPGQVSV-NRSTAAMKYGFPSLSNIKSRESYVTSYD-PRNRTAAWVIEQL 110

  Fly   148 DVYYKTFFPKRPFVEFVADEMFSPQEAAAYMKSNIYFAFKCIYGDDQSYLQNANY--LVINRGHM 210
            :....|....|.:.||..||     ....|.:|:                 ||:|  ...:|||:
Zfish   111 NAETVTGSSDRKYCEFKEDE-----SVHVYHRSS-----------------NADYKGSGFDRGHL 153

  Fly   211 VASADFLFTDQ-MGSTFRYLNVVPQFKSINDGNWEKIERWVRSQIPKSSYFRVKSGGIGILTLP- 273
            .|:|:..::.: |..||...||.||..::|...|..:|::.||   .:.:::......|.|.|| 
Zfish   154 AAAANHKWSQKAMDETFYLSNVSPQNPNLNQNAWNNLEKYCRS---LTKHYQNVFVCTGPLYLPR 215

  Fly   274 ---DTRGFLQSAFLAGSKIPVPEWTYKAV 299
               |.:.:::...|..:.:.||...:|.|
Zfish   216 QEADGKMYVKYQVLGKNHVAVPTHFFKVV 244

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12917NP_610558.2 Endonuclease_NS 129..353 CDD:214889 45/182 (25%)
endogNP_001019385.1 NUC 89..293 CDD:214683 45/183 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.