DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1371 and AT3G62360

Sequence 1:NP_610551.1 Gene:CG1371 FlyBaseID:FBgn0033482 Length:1199 Species:Drosophila melanogaster
Sequence 2:NP_191795.1 Gene:AT3G62360 AraportID:AT3G62360 Length:1227 Species:Arabidopsis thaliana

Alignment Length:1311 Identity:360/1312 (27%)
Similarity:580/1312 (44%) Gaps:218/1312 (17%)


  Fly     7 VFVILLIKLFQNANAGEVEVVGCGGFIK-----------SHAEIDFSRVEIKLLTKQGSLKDKTD 60
            ||:|.:..:: ..:|..::  |||||::           |..::|||.:.::|.|..|.:||.|.
plant    13 VFLIAISTVY-GVSADSIK--GCGGFVEASSSLVRSRKGSDGKLDFSHITVELQTVDGLVKDSTQ 74

  Fly    61 CSPSNGYYFLPIYDKGDYLLSISPPPGWSFEPEQVELNFDGKTDVCSQGRDVNFVFKGFGITGQV 125
            |:| |||||:|:||||.::|.|:.|.|||:.|::|.:..|..:  |:...|:||.|.||.::|:|
plant    75 CAP-NGYYFIPVYDKGSFILKINGPDGWSWNPDKVTVVVDDSS--CNNNDDINFHFTGFTLSGKV 136

  Fly   126 ALAAG--------GGARGVDVELRSEQGE---VRRTKSDANGVFSFTPIIPGNYVVKASHARWHF 179
            ..|.|        ||...|:|||.|..|.   |....:.::|.:.|..||||.|.::|||.... 
plant   137 LGAVGGESCLIKNGGPADVNVELLSSDGSEDPVASVLTSSDGSYLFKNIIPGTYNIRASHPELQ- 200

  Fly   180 SKAEHKVVVVSGNTELP---ANSLV-----VSGFDVVGRFDSSSPLPGN--LGVALYKKKGQSLV 234
                   |.|.|:||:.   ||.:|     |.|:|:.|    |....||  |||.:|.......:
plant   201 -------VEVRGSTEVELGFANGMVDDIFFVLGYDLKG----SVVAQGNPILGVHIYLHSDDVSM 254

  Fly   235 PKCETSSPAPPNSVNSAYESASSCFSQLDKSGEYIFKNVPSGKYLLQAINLDSKLKLHLSPELLE 299
            ..|      |..|.::|.|..|.|.:..|..|.:.||::|.|||.|............:||.::.
plant   255 VDC------PQGSGDAAGERKSLCHAVSDAEGIFSFKSIPCGKYELVPHYKGENTVFDVSPPVMP 313

  Fly   300 LEVGKDTLQIKDEFKITGFTVSGRVL--TSAGGEPLKSAVIKVNGKKVAETDAQGSYTLEN---- 358
            :.|....:.:..:|::|||::.|||:  .|.|.|.:|   |.|:|...:.||.:|.|.|:.    
plant   314 VSVEHQHVTVPQKFQVTGFSIGGRVVDGNSVGVEGVK---ILVDGSLRSVTDKEGYYKLDQPAKL 375

  Fly   359 -------------LKAGTVN----IEVESSQ---------LQFSPLQVKAQI--NTASLPTIVPS 395
                         |::...|    ::|.|:|         .:|..|: |..:  |.||||.|...
plant   376 VVTQPLLVNFLRLLESRVKNMARFLKVTSNQYTIDAVKEHYKFDKLK-KFMVLPNMASLPDINAV 439

  Fly   396 AYEVCGKV---VSPKSHNVGLTKIGSTFHSSASTNAETGNWCAFLPVGKYTIEVLTTDADKAAGV 457
            :|::||.|   .|.....|.||...:..........|||.:|..:|.|:|.:..|......|:.:
plant   440 SYDICGVVRMFGSRHKAKVALTHGPTNVKPQMKLTDETGAFCFEVPPGEYRLSALAATPKGASEL 504

  Fly   458 QFFPVQQQTEVRDAPVNGITFSQLRAKIRGELQCLPDATATCTSAEVTLQALDATGQPTENKWKA 522
            .|.|......|: :|:..|.|||.|..:.|.:.|    ...| ...|::..:.|.|...:.....
plant   505 LFLPAYVDVAVK-SPLLNIEFSQARVNVHGSVTC----KEKC-GPSVSVVLVGAAGDRDKKTVVL 563

  Fly   523 RAHRGKYVFKDMLPGPYELTI---------PQGNLCYESTRVFLNVASAEEDAPPFVHKGYEVSI 578
            .....:::|.|:|||.|.:.:         .:.:.|::.:.:.:||.:.:.....||.|||.::|
plant   564 TDESSQFLFSDILPGKYRVEVKSISPEAASDEDSWCWDRSSIDVNVGTEDIKGIEFVQKGYWINI 628

  Fly   579 ISSHRALMKYTHVTGPSEPKAPTESLKIASGVNTFCVKKYGSYDFKL-EGCHTY-DESLPSKFIT 641
            ||:|....:..|..|     :|| ||||..|....|::..|.::.:| :.|.:: ..|:......
plant   629 ISTHEVDARIAHPDG-----SPT-SLKIKKGSQKICIESPGGHELQLSDSCMSFGSNSIKIDVSN 687

  Fly   642 PEPDQLQTLIINAVAHKTGVRVLSTEPTADSIK------LVLESESLGQEVITPVAESHKVDGKF 700
            |:|       |:..|.|..::.|....::.:|:      .:::.:.....||..:|.....||..
plant   688 PQP-------IHLKAEKYLLKGLINVESSSTIESELQENFIVDIQDKKGNVINTIAAKLASDGSG 745

  Fly   701 AYRYDTYLKPEQVLRITP------VSDVLLFAPQQ-HEIVGSSDCVDIAFNFVATRGLILRGKVV 758
            .|.|.|:....:.:...|      |...:||.|:: |.:|....|......|....||.::|.|.
plant   746 VYEYYTWASLGEKISFVPQDSRGNVEKKMLFYPKEIHAVVSKDGCQASVSPFTGRLGLYIQGSVS 810

  Fly   759 PAIKDAKITLSFPDQPELESL-------EVLTSVTGEFKFGPIEESLAFDLKAEKESYVFSDYNR 816
            |.:....|.:.......:.||       |..|...|.|..||:.:.:.:..:|.|..|...... 
plant   811 PPLPGVNIKIFAAKDSLISSLKKGEIAIETSTLSAGSFVAGPLYDDIPYATEASKPGYHIKRLG- 874

  Fly   817 QTASFSAHKLCEISVVV--KDEAGQTLGGVLLSLSGGESYRKNLVTGDNGAINFHSLSPSQYYLR 879
             ..|||..||.:|||.|  ||.|..::..:||||||...||.|.::|..|...|.||.|..:|||
plant   875 -PYSFSCQKLGQISVRVNSKDNAETSIPPLLLSLSGDHGYRNNSISGAGGLFVFDSLFPGNFYLR 938

  Fly   880 PMMKEYKFEPNSKMIDIKDGETVSVTLVGKRFAYSIFGTVSSLNGDPFAGVNVQATADNSCPQQP 944
            |::|||.|:|::..|::..||:........|.|||..|.|:.|:|.|..||.::|.:|:.  ...
plant   939 PLLKEYSFKPSTLAIELNSGESSEAVFEATRVAYSAMGRVALLSGQPQEGVAIEARSDSK--GYY 1001

  Fly   945 EEATSEANGQYRIRGLQPGCSYSVRVVPDKEI------VERSIPAQHTVKVANEDVRDINLVAIS 1003
            ||.||:.||.||:|||.|..:|.::|  .|:|      :||:.|...::::..||:..::.:...
plant  1002 EETTSDINGNYRLRGLHPDTAYVIKV--SKKIGSANNQIERASPESVSLQIGYEDINGLDFLVFE 1064

  Fly  1004 PLKIVDITARVTATLNEHYKTLRIVMYRKGNSDSPVFSQRVGTPVNPKARLNPGITVFFPRIPLD 1068
            ..:...:|..|....||...:..:|..:.....|.:.:      |.|....|     ||....|.
plant  1065 QPETTILTCHVEGKQNEDLNSNLLVEIKSAIDKSKIEN------VFPLPLSN-----FFQVKGLP 1118

  Fly  1069 GKSYVVELQSTLSDKTYTYKLPSTTFVADRGSVFVELEFKPEVR--------AAEADLNQNSISA 1125
            ...::|:|:|  |....::|:.|.         .:|::|:...:        :..||.....::.
plant  1119 KGKHLVQLKS--SRPLISHKVESE---------IIEVDFETNAQIHIGPLRYSIVADHQSQEVTP 1172

  Fly  1126 LVLIALV----AIAFFKQDLATSFLSFVWSKLNDV-AADLAQRQKSKTQVRKNEPINQREIEQMA 1185
            ..::.||    |||.        |||.  .:|.|: .|.:.......|...|.||          
plant  1173 AAILPLVIGVSAIAL--------FLSI--PRLKDIYQATVGISSPGFTTSAKREP---------- 1217

  Fly  1186 DQINAIKKKKT 1196
              ..|:.:|||
plant  1218 --RKAVARKKT 1226

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1371NP_610551.1 CarboxypepD_reg 120..198 CDD:290350 29/92 (32%)
CarboxypepD_reg 319..>370 CDD:290350 18/74 (24%)
Peptidase_M14NE-CP-C_like 841..905 CDD:304370 27/64 (42%)
CarboxypepD_reg 914..>970 CDD:290350 23/56 (41%)
AT3G62360NP_191795.1 CarboxypepD_reg 131..212 CDD:290350 28/89 (31%)
Cna_B 543..>585 CDD:283411 9/42 (21%)
CarboxypepD_reg 976..>1029 CDD:290350 23/57 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H13810
Inparanoid 1 1.050 396 1.000 Inparanoid score I472
OMA 1 1.010
OrthoDB 1 1.010 D839381at2759
OrthoInspector 1 1.000 T192537
orthoMCL 1 0.900 OOG5_132415
Panther 1 1.100 LDO PTHR23303
Phylome 1 0.910 0.857 Consistency score
98.980

Return to query results.
Submit another query.