DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1371 and nomo

Sequence 1:NP_610551.1 Gene:CG1371 FlyBaseID:FBgn0033482 Length:1199 Species:Drosophila melanogaster
Sequence 2:XP_002662361.1 Gene:nomo ZFINID:ZDB-GENE-040826-3 Length:1208 Species:Danio rerio

Alignment Length:1261 Identity:385/1262 (31%)
Similarity:626/1262 (50%) Gaps:150/1262 (12%)


  Fly     6 GVFVILLIKL----FQNANAGEVEVVGCGGFIKSHAEIDFSRVEIKLLTKQGSLKDKTDCSPSNG 66
            |:..:.::.|    |...||.:..:||||||:||..||::|.:||||.|||||||.:|||:|.||
Zfish     3 GIKELAILTLSFLYFTFVNATDDILVGCGGFVKSDVEINYSVIEIKLYTKQGSLKYQTDCAPING 67

  Fly    67 YYFLPIYDKGDYLLSISPPPGWSFEPEQVELNFDGKTDVCSQGRDVNFVFKGFGITGQVALAAGG 131
            |:.:|:|||||::|.|.||.||||||..|:|:.||.||:|::.:|:||||.||.:.|.| |:.|.
Zfish    68 YFMIPLYDKGDFVLKIEPPSGWSFEPTTVDLHVDGVTDICTKEQDINFVFTGFSVLGTV-LSKGH 131

  Fly   132 --GARGVDVELR--SEQGEVRRTKSDANGVFSFTPIIPGNYVVKASHARWHFSKAEHKVVVVSGN 192
              |..||:|.||  .|...::...:.|.|.::|..::||:|.:.|||:.|...::...|||  .|
Zfish   132 LLGPAGVEVSLRKAGEDAVLQSVFTHAGGQYTFLKVLPGSYDITASHSSWTLEQSSTAVVV--SN 194

  Fly   193 TELPANS-LVVSGFDVVGRFDS-SSPLPGNLGVALYKKKGQSLVPKCETS--SPAPPNSVNSAYE 253
            ...||.: |||.|:||.|...| |.|:.| :...||    .:.|.|.:.|  :.||   |:.|..
Zfish   195 ENAPAAAPLVVKGYDVSGEVQSDSEPMKG-VSFLLY----SASVTKEDISGCAVAP---VDGALV 251

  Fly   254 SASS----CFSQLDKSGEYIFKNVPSGKYLLQAINLDSKLKLHLSPELLELEVGKDTLQIKDEFK 314
            ..:|    |.||..:.|.:.|..:|||:|.:.......::...::|..::.:|...:|.::..|:
Zfish   252 GDASLVYLCSSQSREDGTFSFPCLPSGEYTVVPYYRGERITFDVAPSRMDFKVEHSSLTLQPVFR 316

  Fly   315 ITGFTVSGRVLTSAGGEPLKSAVIKVNGKKVAETDAQGSYTLENLKAGTVNIEVESSQLQFSPLQ 379
            :.||:|.||||....||.:..||:.:|.:...||...||:.|||:..||..|......:.|.|:.
Zfish   317 VMGFSVMGRVLNGPDGEGVADAVVTLNNQIKVETKEDGSFRLENMTTGTYTINTHKELMFFEPVT 381

  Fly   380 VKAQINTASLPTIVPSAYEVCGKVVSPKSHNVGLTKIGST-------------------FHSSAS 425
            ||...:|..||.|:.:.:.|||        ::.:|::..|                   |..:..
Zfish   382 VKIAPSTPQLPDIITAGFSVCG--------HISVTRLPETVKQLGRYKVTLSAQRQDQGFFRTVE 438

  Fly   426 TNAETGNWCAFLPVGKYTIEVLTTDADKAAGVQFFPVQQQTEVRDAPVNGITFSQLRAKIRGELQ 490
            :::. |.:|..:..|.|:::|...:::..||:...|......:.|.||..:.|:|..|.:.|.:.
Zfish   439 SDSH-GAFCFQVKPGDYSVQVTLPESEVKAGLALQPHSLDISLVDRPVTDLLFTQFIASVSGSVS 502

  Fly   491 CLPDATATCTSAEVTLQALDATGQPTENKWKARAHRGKYVFKDMLPGPYELTIPQGNLCYESTRV 555
            ||    ..|....|:||.:...|:....:....:....:.|.::|||.|:::|.|...|::...|
Zfish   503 CL----VACGDLTVSLQPVSRQGERQNFQLSGSSETLTFTFGNVLPGKYKVSITQEEWCWKHKSV 563

  Fly   556 FLNVASAEEDAPPFVHKGYEVSIISSHRALMKYTHVTGPSEPKAPTESL---KIASGVNTFCVKK 617
            .::|..:..:...|...||.:....||...:::.     .:...| |::   .::.|||.||:.|
Zfish   564 EIDVLDSYVEGVEFRQTGYLLRCSLSHAITLEFF-----QDGSLP-ENVGVYNLSKGVNRFCLSK 622

  Fly   618 YGSYDFKLEGCH-------TYDESLPSKFITPEPDQLQTLIINAVA-HKTGVRVLSTEPTAD--- 671
            .|.|......||       ||:.|.||           .|.:.||. |.||  :::|:...|   
Zfish   623 PGVYKVTPRSCHQFEQDYYTYNTSAPS-----------ILTLTAVRHHMTG--LITTDKMLDVTV 674

  Fly   672 SIKLVLESE-------------------------------SLGQEVITPVAES-HKVDGKFAYRY 704
            :||..:|||                               ..|.|...||.|. .::...|.|.:
Zfish   675 TIKSSIESEPALVLGPLRSNEEQRREQQLLEIAARKKERGEAGDEKSPPVEEKPEELREPFHYEF 739

  Fly   705 DTYLKPEQVLRITPVSDVLLFAPQQHE-IVGSSDCVDIAFNFVATRGLILRGKVVPAIKDAKITL 768
            ..:.:..:.:.:||.|...||.|.:.| .:...:|...........||.|.|:|.|.::..:||:
Zfish   740 SYWARAGEKITVTPSSKEFLFYPPEVEATITGENCPGRLVEITGRAGLFLTGQVAPTLEGVEITI 804

  Fly   769 SFPDQPELESLEVLTSVTGEFKFGPIEESLAFDLKAEKESYVFSDYNRQTASFSAHKLCEISVVV 833
            . ..:.....:.|||...|.:..||:.....:|:.|.||.:|.:....:|..|.|..|..::..:
Zfish   805 K-ESKATTPLITVLTDENGAYSVGPLHSDSQYDISASKEGFVLTPVEGKTGDFKAFALAGVTFEI 868

  Fly   834 KDEAGQTLGGVLLSLSGGESYRKNLVTGDNGAINFHSLSPSQYYLRPMMKEYKFEPNSKMIDIKD 898
            |.|.|..|.||||||||. |:|.||:|.|.|.:.|::|||.|||.:|||||::|||:::||.:::
Zfish   869 KAEDGVPLSGVLLSLSGA-SFRSNLLTQDTGLLTFNNLSPGQYYFKPMMKEFRFEPSAQMITVEE 932

  Fly   899 GETVSVTLVGKRFAYSIFGTVSSLNGDPFAGVNVQATADNSCPQQPEEATSEANGQYRIRGLQPG 963
            |:.:.:.:.|.:.|||.:|||.|:.||...||.|:|...:.|....|:..::..|::|:|||:||
Zfish   933 GQVLHIPITGFKTAYSCYGTVQSIGGDAEQGVAVEAVGQSECGMYSEDTVTDEEGRFRLRGLRPG 997

  Fly   964 CSYSVRVVPD-KEIVERSIPAQHTVKVANEDVRDINLVAISPLKIVDITARVTATLNEHYKTLRI 1027
            |:|::::..: .:.:||::|...|::|.|.|:..||::|...:...|::..| .|..||..||.:
Zfish   998 CNYNIQLRGEGNDHIERALPPHKTIEVGNTDIDGINIIAFRQINQFDLSGNV-ITSPEHLPTLWV 1061

  Fly  1028 VMYRKGNSDSPVFSQRVGTPVNPKARLNPGITVFFPRIPLDGKSYVVELQSTLSDKTYTYKLPST 1092
            .:|:..|.|:|..|..:|          ..:...|..:|.||:|||:.|.::||...|.:|||..
Zfish  1062 KLYKSDNLDNPFQSVSLG----------QSLFFHFQPLPRDGESYVLMLDTSLSRSQYDFKLPQV 1116

  Fly  1093 TFVADRGSVFVELEFKPEVRAAEADLNQNSISALVLIALVAIAFFKQDLATSFLSFVWSKLNDV- 1156
            :|.:......|.|.|.|:.:..:.|:.|.|..||.|..|:.:|.:..:.....|..:.|::..| 
Zfish  1117 SFTSSGYHKHVTLTFNPKRKIPDQDVAQGSFIALPLTLLLLLAVYNHERVIPLLLQLVSQIQGVR 1181

  Fly  1157 ----------AADLAQRQKSKTQVRK 1172
                      ..|.|:|...:.:.|:
Zfish  1182 GLAQASGDGLPVDEAKRPSKRPKTRR 1207

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1371NP_610551.1 CarboxypepD_reg 120..198 CDD:290350 27/82 (33%)
CarboxypepD_reg 319..>370 CDD:290350 20/51 (39%)
Peptidase_M14NE-CP-C_like 841..905 CDD:304370 34/64 (53%)
CarboxypepD_reg 914..>970 CDD:290350 22/56 (39%)
nomoXP_002662361.1 CarboxypepD_reg 121..203 CDD:290350 27/85 (32%)
CarboxypepD_reg 321..>368 CDD:290350 19/47 (40%)
CarboxypepD_reg 422..480 CDD:290350 9/59 (15%)
Cna_B 861..>913 CDD:283411 27/53 (51%)
CarboxypepD_reg 951..>1008 CDD:290350 21/57 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C329758082
eggNOG 1 0.900 E1_KOG1948
Hieranoid 1 1.000
Homologene 1 1.000 H13810
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D361344at33208
OrthoFinder 1 1.000 FOG0003154
OrthoInspector 1 1.000 T1051659
orthoMCL 1 0.900 OOG5_132415
Panther 1 1.100 LDO PTHR23303
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.720

Return to query results.
Submit another query.