DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1371 and nra-4

Sequence 1:NP_610551.1 Gene:CG1371 FlyBaseID:FBgn0033482 Length:1199 Species:Drosophila melanogaster
Sequence 2:NP_872191.1 Gene:nra-4 WormBaseID:WBGene00015344 Length:1123 Species:Caenorhabditis elegans

Alignment Length:1217 Identity:323/1218 (27%)
Similarity:554/1218 (45%) Gaps:160/1218 (13%)


  Fly     9 VILLIKLFQNANAGEVEVVGCGGFIKSHAEIDFS--RVEIKLLTKQGSLKDKTDCSPSNGYYFLP 71
            :|||..|...|.|   .|..|.|.:||.:.:|:|  :::::|||.:|.:|.:.:.:|||||:.:|
 Worm     6 LILLSLLLPGALA---NVYSCAGSVKSTSPVDYSQLKLQVRLLTLEGHMKHEEEVNPSNGYFMIP 67

  Fly    72 IYDKGDYLLSISPPPGWSFEPEQVELNFDGKTDVCSQGRDVNFVFKGFGITGQVALAAGGGARGV 136
            :|:||.|.|.:|.|.|:.|||:.:|:..|||||.||...|:.|...||.:.|.|    .|.|.|:
 Worm    68 VYNKGHYTLKVSAPAGYYFEPDSIEIKIDGKTDACSLNEDLVFHLTGFSVRGTV----DGAAAGL 128

  Fly   137 DVELRSEQGEVRRTKSDANGVFSF-TPIIPGNYVVK-ASHARWHFSKAEHKV------VVVSGNT 193
            .:.|.....::..||::..|.:.. .|  ||.|.|. .:.|....||.:..|      |||:.|.
 Worm   129 PLVLTENGKQIAETKTEDGGKYEMRAP--PGKYEVSTGAGASECISKGKTSVEVKNAPVVVTPNF 191

  Fly   194 ELPANSLVVSGF--DVVGRFDSSSPLPGNLGVALYKKKGQSLVPKCETSSPAPPN--------SV 248
            :       :||:  :|..|.:|.:|....: :.||           .|||...||        |:
 Worm   192 K-------ISGYQLEVHTRTESMNPFVDAV-MTLY-----------ATSSIDLPNIKCVGSEGSL 237

  Fly   249 NSAYESASSC-FSQLDKSGEYIFKNVPSGKYLLQAINLDSKLKLHLSPELLELEVGKDTLQIKDE 312
            |........| ..:.|..|......||||:|.|.|.:::....::.||...::.|.    |...|
 Worm   238 NVPSTHNVKCSIGKTDPRGRLSVACVPSGEYYLAASHVNGPKSINFSPNPQKVVVS----QAASE 298

  Fly   313 FKITGFTVSGRVLTSAGGEPLKSAVIKVNGKKVAETDAQGSYTLENLKAGT-VNIEVESSQLQFS 376
            .:....:.:|||..::...||....:.||.|...:||:||...:||||... ..|..::...|||
 Worm   299 ARFVAQSATGRVRVTSKDLPLSGVEVLVNEKSGGKTDSQGYLKIENLKEDEHTTITAKAPNTQFS 363

  Fly   377 PLQVKAQINTASLPTIVPSAYEVCGKVVSPKSHNVGLTKIGSTF------HSSASTNAETGNWCA 435
            .:....:.....:..:....:::||:|  .||.|..|.|:  ||      .|........|::|.
 Worm   364 TVHANVKFPKVEIQDVTVQKFDICGQV--EKSENGVLGKL--TFTRKDDKRSLEIQPKADGSFCQ 424

  Fly   436 FLPVGKYTIEVLTTDADKAAGVQFFPVQQQTEVRDAPVNGITFSQLRAKIRGELQCLPDATATCT 500
            .:..|.:|||    ..||.:.:.  |...:.||....|..:.|:..:......|.|:    ..|.
 Worm   425 PVSPGLFTIE----PTDKTSSLT--PRLLEVEVLKNAVTNLRFTHFKTNANVHLSCI----GACP 479

  Fly   501 SAEVTL----QALDATGQPTENKWKARAHRGK--YVFKDMLPGPYELTI-PQGNLCYESTRVFLN 558
            :|.|:|    |.|            .|:.:|.  :.|:::.||.|...: ..|..|:|.:.:.|.
 Worm   480 TATVSLFLPGQTL------------VRSVKGTDVFTFENIGPGTYSARLDDNGRGCWEKSEMTLV 532

  Fly   559 VASAEEDAPPFVH---KGYEVSIISSHRALMKYTH-----VTGPSEPKAPTESLKIASGVNTFCV 615
            |  .:.:..|.:|   .|:...|..||.|.:::::     :.|.:..|        ...|.:.||
 Worm   533 V--EQSNTQPTIHFKQNGFAAQIEISHPAEIEWSNADKKQLNGKTSTK--------GGEVISICV 587

  Fly   616 KKYGSYDFKLEGCHTYDE-----SLPSKFITPEPDQLQTLIINAVAHK-TGVRVLSTEPTADSIK 674
            ...|.||..|..|:.::.     ::|...:..|         .|||.: :|...|..:..| ::.
 Worm   588 PTSGVYDVSLGSCYKFERQQFKLTVPFDGVHKE---------KAVAARISGTIDLENDKNA-AVS 642

  Fly   675 LVLESESLGQEVITPVAESHKVDGKFAYRYDTYLKPEQVLRITPVSDVLLFAPQQHEIVGSSDCV 739
            :.::|.:..:|:..|..:    :|:|.:........||:: |.|.|.:.||.|....:..:..|:
 Worm   643 IRIKSSAGDREIQVPALD----NGRFTFEEPLASSGEQLV-IVPSSKLRLFEPTSKSVTVTGKCI 702

  Fly   740 DIAFNFVATRGLILRGKVVPAIKDAKITLSFPDQPELESLEVLTSVTGEFKFGPIEESLAFDLKA 804
            :.|..|.:.||:.|.|.:.||::.|.:........:: .:|.:::..|.||.||::....:|:.|
 Worm   703 ENAVKFNSFRGIFLDGSIKPAVEKAVVKAVLKKDKDV-VIEAISNKDGAFKIGPVKRVEDYDITA 766

  Fly   805 EKESYVFSDYNRQTASFSAHKLCEISVVVKDE-AGQTLGGVLLSLSGGE----SYRKNLVTGDNG 864
            ..:.:.|:. ......|.:.||.::|:.|.|| ....|.||||||.||:    .||.|.|..:..
 Worm   767 TLDGFKFTP-TSTPGHFQSVKLSQLSIKVVDEVTNAPLDGVLLSLVGGKGAGSDYRSNNVLDETA 830

  Fly   865 AINFHSLSPSQYYLRPMMKEYKFEPNSKMIDIKDGETVSVTLVGKRFAYSIFGTVSSLNGDPFAG 929
            ..|:.:|:|.:|::|.:::||||.|::..|.:|:|:..:|.|.|||.::|.:|.:..::||....
 Worm   831 HKNYVALAPGEYFVRAILQEYKFSPSTSTIVVKEGQHENVVLKGKRVSFSAYGKMREMSGDAMKD 895

  Fly   930 VNVQATADNSCPQQPEEATSEANGQYRIRGLQPGCSYSV--RVVPDKEIVERSIPAQHTVKVANE 992
            |.::|.:: .|.....|||::.:|.||||||.|.|.|.|  :...|......|.|...||.:..|
 Worm   896 VIIEALSE-GCDLHQSEATTKEDGTYRIRGLLPDCEYQVHAKSYADGSPAPHSFPRSFTVSMTAE 959

  Fly   993 DVRDINLVAISPLKIVDITARVTATLNEHYKTLRIVMYRKGNSDSPVFSQRVGTPVNPKARLNPG 1057
            ||:.:..:|....|..||...:........:::|:|: .|.|:|    ..:|.:.|.|: .|:  
 Worm   960 DVKGLEFMATITAKTTDIAVEIGMDTLPEIQSVRVVI-TKNNND----HVQVASVVAPQ-HLH-- 1016

  Fly  1058 ITVFFPRIPLDGKSYVVELQSTLSDKTYTYKLPSTTFVADRGSVFVELEFKPEVRAAEADLNQNS 1122
               :...:|.||..|.:.:::....:.:..|  :...|||:......:......||.:.|::..:
 Worm  1017 ---YLVNLPRDGVEYAIRVEAEKPPQAFAAK--TVRVVADQAMKVARVPLTSSKRANDVDISVGT 1076

  Fly  1123 ISALVLIALVAIAFFKQDLATSFL-SFV-WSKLNDVA--ADLAQRQK 1165
            ..:|.....:|:.||.|:.....| :|: |:: |..|  ||...|::
 Worm  1077 FLSLPFFVTLALVFFNQNRVLELLGTFIDWAR-NTFAPTADNHHRKR 1122

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1371NP_610551.1 CarboxypepD_reg 120..198 CDD:290350 22/86 (26%)
CarboxypepD_reg 319..>370 CDD:290350 17/52 (33%)
Peptidase_M14NE-CP-C_like 841..905 CDD:304370 27/68 (40%)
CarboxypepD_reg 914..>970 CDD:290350 21/58 (36%)
nra-4NP_872191.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C328883504
eggNOG 1 0.900 E1_KOG1948
Hieranoid 1 1.000
Homologene 1 1.000 H13810
Inparanoid 1 1.050 364 1.000 Inparanoid score I1258
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D361344at33208
OrthoFinder 1 1.000 FOG0003154
OrthoInspector 1 1.000 T475301
orthoMCL 1 0.900 OOG5_132415
Panther 1 1.100 LDO PTHR23303
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3347
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.