DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1371 and NOMO1

Sequence 1:NP_610551.1 Gene:CG1371 FlyBaseID:FBgn0033482 Length:1199 Species:Drosophila melanogaster
Sequence 2:NP_055102.3 Gene:NOMO1 HGNCID:30060 Length:1222 Species:Homo sapiens

Alignment Length:1249 Identity:397/1250 (32%)
Similarity:627/1250 (50%) Gaps:131/1250 (10%)


  Fly     9 VILLIKLFQNANAGEVEVVGCGGFIKSHAEIDFSRVEIKLLTKQGSLKDKTDCSPSNGYYFLPIY 73
            |:||:.....|:..|..|||||||:||..||::|.:||||.||.|:||.:|||:|:|||:.:|:|
Human    19 VVLLLSGVGPAHGSEDIVVGCGGFVKSDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGYFMIPLY 83

  Fly    74 DKGDYLLSISPPPGWSFEPEQVELNFDGKTDVCSQGRDVNFVFKGFGITGQVALAAGG--GARGV 136
            ||||::|.|.||.||||||..|||:.||.:|:|::|.|:||||.||.:.|:| |:.|.  |..||
Human    84 DKGDFILKIEPPLGWSFEPTTVELHVDGVSDICTKGGDINFVFTGFSVNGKV-LSKGQPLGPAGV 147

  Fly   137 DVELRS--EQGEVRRTKSDANGVFSFTPIIPGNYVVKASHARWHFSKAEHKVVVVSGNTELPANS 199
            .|.||:  .:.:::.|.:...|.|:|..::||:|.:.|:|..|...:|...|.|.:.|.. .|:.
Human   148 QVSLRNTGTEAKIQSTVTQPGGKFAFFKVLPGDYEILATHPTWALKEASTTVRVTNSNAN-AASP 211

  Fly   200 LVVSGFDVVGRFDS-SSPLPGNLGVALYKKKGQSLVPK-----CETSSPAP---PNSVNSAYESA 255
            |:|:|::|.|...| ..|:.| :...|:    .|||.|     |.. ||.|   |...:..|   
Human   212 LIVAGYNVSGSVRSDGEPMKG-VKFLLF----SSLVTKEDVLGCNV-SPVPGFQPQDESLVY--- 267

  Fly   256 SSCFSQLDKSGEYIFKNVPSGKYLLQAINLDSKLKLHLSPELLELEVGKDTLQIKDEFKITGFTV 320
             .|::...:.|.:.|.::|||.|.:.......::...::|..|:..|..|:|:|:..|.:.||:|
Human   268 -LCYTVSREDGSFSFYSLPSGGYTVIPFYRGERITFDVAPSRLDFTVEHDSLKIEPVFHVMGFSV 331

  Fly   321 SGRVLTSAGGEPLKSAVIKVNGKKVAETDAQGSYTLENLKAGTVNIEVESSQLQFSPLQVKAQIN 385
            :||||....|:.:..||:.:|.:...:|.|.||:.|||:..||..|..:...|.|..:.:|...|
Human   332 TGRVLNGPEGDGVPEAVVTLNNQIKVKTKADGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPN 396

  Fly   386 TASLPTIVPSAYEVCGKVV------SPKSHNVGLTKIGSTFHSSASTNAET---GNWCAFLPVGK 441
            |..|..|:.:.:.|||::.      :.|..|.....:.|.....:....||   |::|.....|.
Human   397 TPQLADIIATGFSVCGQISIIRFPDTVKQMNKYKVVLSSQDKDKSLVTVETDAHGSFCFKAKPGT 461

  Fly   442 YTIEVLTTDADKAAGVQFFPVQQQTEVRDAPVNGITFSQLRAKIRGELQCLPDATATCTSAEVTL 506
            |.::|:..:|:..||:...|......|.:.|:..:.|.|..|.:.|::.||.    ||....|||
Human   462 YKVQVMVPEAETRAGLTLKPQTFPLTVTNRPMMDVAFVQFLASVSGKVSCLD----TCGDLLVTL 522

  Fly   507 QALDATGQPTENKWKARAHRGKYVFKDMLPGPYELTIPQGNLCYESTRVFLNVASAEEDAPPFVH 571
            |:|...|:....:...:.:...:.|.::|||.|:::|...:.|:::..:.:.|...:..|..|..
Human   523 QSLSRQGEKRSLQLSGKVNAMTFTFDNVLPGKYKISIMHEDWCWKNKSLEVEVLEDDMSAVEFRQ 587

  Fly   572 KGYEVSIISSHRALMKYTHVTGPSEPKAPTESLKIASGVNTFCVKKYGSYDFKLEGCH------- 629
            .||.:....||...::: :..|.........:|  :.|||.||:.|.|.|......||       
Human   588 TGYMLRCSLSHAITLEF-YQDGNGRENVGIYNL--SKGVNRFCLSKPGVYKVTPRSCHRFEQAFY 649

  Fly   630 TYDESLPSKFITPEPDQLQTLIINAVAHKTGVRVLSTEPTAD---SIKLVLESESL--------- 682
            |||.|.||           .|.:.|:.|.. :..::|:...|   :||..::||..         
Human   650 TYDTSSPS-----------ILTLTAIRHHV-LGTITTDKMMDVTVTIKSSIDSEPALVLGPLKSV 702

  Fly   683 --------------------------GQEVIT--PVAES-HKVDGKFAYRYDTYLKPEQVLRITP 718
                                      |:|.:|  ||.|. .::.|.|:|.:..:.:..:.:.:||
Human   703 QELRREQQLAEIEARRQEREKNGNEEGEERMTKPPVQEMVDELQGPFSYDFSYWARSGEKITVTP 767

  Fly   719 VSDVLLFAPQQHE-IVGSSDCVDIAFNFVATRGLILRGKVVPAIKDAKITLSFPDQPELES--LE 780
            .|..|||.|...| :|....|...........||.|.|::.|.::..:|.:|   :....|  :.
Human   768 SSKELLFYPPSMEAVVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVIS---EKGASSPLIT 829

  Fly   781 VLTSVTGEFKFGPIEESLAFDLKAEKESYVFSDYNRQTASFSAHKLCEISVVVKDEAGQTLGGVL 845
            |.|...|.:..||:...|.:.:.::||.||.:........|.|:.|..:|..:|.|..|.|.|||
Human   830 VFTDDKGAYSVGPLHSDLEYTVTSQKEGYVLTAVEGTIGDFKAYALAGVSFEIKAEDDQPLPGVL 894

  Fly   846 LSLSGGESYRKNLVTGDNGAINFHSLSPSQYYLRPMMKEYKFEPNSKMIDIKDGETVSVTLVGKR 910
            |||||| .:|.||:|.|||.:.|.:|||.|||.:|||||::|||:|:||::::|:.:.:|:.|.|
Human   895 LSLSGG-LFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYR 958

  Fly   911 FAYSIFGTVSSLNGDPFAGVNVQATADNSCPQQPEEATSEANGQYRIRGLQPGCSYSVRVVPD-K 974
            .|||.:||||||||:|..||.::|...|.|....|:..::..|::|:|||.|||.|.|::..: .
Human   959 TAYSCYGTVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGN 1023

  Fly   975 EIVERSIPAQHTVKVANEDVRDINLVAISPLKIVDITARVTATLNEHYKTLRIVMYRKGNSDSPV 1039
            :.:||::|....::|.|.|:.|:|::....:...|::..| .|.:|:..||.:.:|:..|.|:|:
Human  1024 DHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNV-ITSSEYLPTLWVKLYKSENLDNPI 1087

  Fly  1040 FSQRVGTPVNPKARLNPGITVFFPRIPLDGKSYVVELQSTLSDKTYTYKLPSTTFVADRGSVFVE 1104
              |.|.        |...:...||.:..||::|||.|.|||....|.|.||..:|.|......:.
Human  1088 --QTVS--------LGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYILPQVSFTAVGYHKHIT 1142

  Fly  1105 LEFKPEVRAAEADLNQNSISALVLIALVAIAFFKQDLATSFLSFVWSKLNDVAA----------- 1158
            |.|.|..:..|.|:.|.|..||.|..||.:|.:..|.....|..:.|:|..|.|           
Human  1143 LIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASDNSGP 1207

  Fly  1159 DLAQRQKSKTQVRK 1172
            :.|:||..|.:.|:
Human  1208 EDAKRQAKKQKTRR 1221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1371NP_610551.1 CarboxypepD_reg 120..198 CDD:290350 25/82 (30%)
CarboxypepD_reg 319..>370 CDD:290350 19/51 (37%)
Peptidase_M14NE-CP-C_like 841..905 CDD:304370 36/64 (56%)
CarboxypepD_reg 914..>970 CDD:290350 26/56 (46%)
NOMO1NP_055102.3 CarboxypepD_reg 130..>188 CDD:290350 19/59 (32%)
CarboxypepD_reg 330..403 CDD:290350 25/73 (34%)
Cna_B 875..>927 CDD:283411 29/53 (55%)
CarboxypepD_reg 965..1048 CDD:290350 33/83 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C329766015
eggNOG 1 0.900 E1_KOG1948
Hieranoid 1 1.000
Homologene 1 1.000 H13810
Inparanoid 1 1.050 609 1.000 Inparanoid score I907
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D361344at33208
OrthoFinder 1 1.000 FOG0003154
OrthoInspector 1 1.000 T608427
orthoMCL 1 0.900 OOG5_132415
Panther 1 1.100 LDO PTHR23303
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3347
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.