DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1371 and nomo3

Sequence 1:NP_610551.1 Gene:CG1371 FlyBaseID:FBgn0033482 Length:1199 Species:Drosophila melanogaster
Sequence 2:NP_001121443.1 Gene:nomo3 XenbaseID:XB-GENE-949390 Length:1209 Species:Xenopus tropicalis

Alignment Length:1215 Identity:392/1216 (32%)
Similarity:611/1216 (50%) Gaps:95/1216 (8%)


  Fly    21 AGEVEVVGCGGFIKSHAEIDFSRVEIKLLTKQGSLKDKTDCSPSNGYYFLPIYDKGDYLLSISPP 85
            |.|..|||||||:||..:|::|.:||||.||||:||.:|||:|.|||:.:|:|||||::|.|.||
 Frog    20 ASEDIVVGCGGFVKSDVDINYSLIEIKLYTKQGTLKYQTDCAPINGYFMIPLYDKGDFVLKIEPP 84

  Fly    86 PGWSFEPEQVELNFDGKTDVCSQGRDVNFVFKGFGITGQV-ALAAGGGARGVDVELRSEQGEV-- 147
            .||||||..|.|:.||..|:|::|.||||||.||.:.|:| :.....|..||.|.:|.....|  
 Frog    85 LGWSFEPTSVPLHVDGVNDICTKGEDVNFVFNGFSVNGKVLSRNQNMGPVGVQVAMRKAGSSVNL 149

  Fly   148 RRTKSDANGVFSFTPIIPGNYVVKASHARWHFSKAEHKVVVVSGNTELPANSLVVSGFDVVGRFD 212
            :.|.:...|.|:||.::||.|.:.|||..|...:|...|.|.:.|.: .||:|:|:|:||.|...
 Frog   150 QTTVTQVGGKFAFTKVLPGEYEIFASHPTWTLKQATTMVQVTNSNAQ-AANALIVAGYDVSGSVR 213

  Fly   213 S-SSPLPGNLGVALYKKKGQSLVPKCETSSPAPPNSVNSAYESAS-SCFSQLDKSGEYIFKNVPS 275
            | ..|:.|.:.:..........:..|:.|   |........||.| .|.....:.|.:.|.::||
 Frog   214 SDGEPMKGVMFLLFSTTTKSEDILGCDLS---PVEGFQGKDESLSYLCHVTSQEDGSFTFLSLPS 275

  Fly   276 GKYLLQAINLDSKLKLHLSPELLELEVGKDTLQIKDEFKITGFTVSGRVLTSAGGEPLKSAVIKV 340
            |.|.:.......::...::|..|:..|..|:|:::..|.:.||:|:||||....|:.:..|::.:
 Frog   276 GDYSVVPYYRGERITFDVAPSRLDFSVEHDSLKLEPVFHVMGFSVTGRVLNGPEGDGVPDAMVTL 340

  Fly   341 NGKKVAETDAQGSYTLENLKAGTVNIEVESSQLQFSPLQVKAQINTASLPTIVPSAYEVCGKVV- 404
            |.:....|:|.||:.|||:.|||.:|:.:...:.|..|.||...||..|..|:.:.:.|||::. 
 Frog   341 NNQMKVVTNADGSFRLENMTAGTYSIDAQKEHIYFDTLTVKIAPNTPQLADIIAARFSVCGQITI 405

  Fly   405 --SPKS------HNVGLTKIGSTFHSSASTNAET-GNWCAFLPVGKYTIEVLTTDADKAAGVQFF 460
              .|::      :.:.||......:...:|.::: ||:|.....|.|.::|...:.|..||:...
 Frog   406 THFPENVRQFSKYKMTLTPQDKERNPVLTTESDSQGNFCFQAKRGSYDLQVTVPEHDARAGLAIK 470

  Fly   461 PVQQQTEVRDAPVNGITFSQLRAKIRGELQCLPDATATCTSAEVTLQALDATGQPTENKWKARAH 525
            |......|.|.||..|:|||..|.:.|::.||.    ||....||||:..............:|.
 Frog   471 PAVFSVTVVDRPVMDISFSQFMASVSGKISCLD----TCGDLTVTLQSTTRQRDKRSVMVSGKAD 531

  Fly   526 RGKYVFKDMLPGPYELTIPQGNLCYESTRVFLNVASAEEDAPPFVHKGYEVSIISSHRALMK-YT 589
            ...:.|:::|||.|:::|.|.:.|:::..:...|...:.....|...|:.:....||...:: |.
 Frog   532 NVPFNFENVLPGKYKVSIVQEDWCWKNKSLEFEVVEEDIVGVEFRQTGFMLRCSLSHAITLEFYQ 596

  Fly   590 HVTGPSEPKAPTESLKIASGVNTFCVKKYGSYDFKLEGCH-------TYDESLPSKF-------- 639
            ...||..    .....::.|||.||:.|.|.|......||       |||.|.||..        
 Frog   597 DGNGPEH----VGVYNLSKGVNRFCLSKPGVYKVTPRSCHRFEHPYYTYDTSSPSILTLTAVRHH 657

  Fly   640 ----ITPEPDQLQ--TLIINAVAHKTGVRVL----STEPTADSIKLV------LESESLGQEVI- 687
                ||  .|||.  |:.|.:........||    |.|.|....::.      ||.|..|.|.. 
 Frog   658 VLGAIT--ADQLMDVTVTIKSSIDSEPALVLGPLKSVEETRREQQMAEIEARRLEREKAGSEDAE 720

  Fly   688 --TPVAE-SHKVDGKFAYRYDTYLKPEQVLRITPVSDVLLFAPQQHE-IVGSSDCVDIAFNFVAT 748
              .||.| ...:.|.|:|.:..:.:..:.:.:||.|..|||.|...| :|...:|..........
 Frog   721 SQPPVQELVDDLQGPFSYEFSYWARSGEKITVTPSSKELLFYPSSVEAVVSGENCPGKMIEIQGK 785

  Fly   749 RGLILRGKVVPAIKDAKITLSFPDQPELESLEVLTSVTGEFKFGPIEESLAFDLKAEKESYVFSD 813
            .||.|.|::.|.::..:|.:|...... ..:.|.|...|.:..||:...|.:.:.|:||.:|.:.
 Frog   786 AGLFLEGQIHPELEGVEIVISEKGAAS-PLITVYTDDKGSYSVGPLHSDLEYTISAQKEGFVMTA 849

  Fly   814 YNRQTASFSAHKLCEISVVVKDEAGQTLGGVLLSLSGGESYRKNLVTGDNGAINFHSLSPSQYYL 878
            .......|:|..|..::..::.|.||.|.||||||||| .:|.||:|.:||.:.|.:|||.|||.
 Frog   850 LEGTMGDFNAFALAGVTFEIRSEDGQPLAGVLLSLSGG-IFRSNLLTQENGMLTFSNLSPGQYYF 913

  Fly   879 RPMMKEYKFEPNSKMIDIKDGETVSVTLVGKRFAYSIFGTVSSLNGDPFAGVNVQATADNSCPQQ 943
            :|||||::|||:|:||:.::|:.:.:|::|.|.|||.:||||||||:|..||:|:|.....|...
 Frog   914 KPMMKEFRFEPSSQMIEAQEGQNLKITIIGHRTAYSCYGTVSSLNGEPEQGVSVEAIGQGDCSIY 978

  Fly   944 PEEATSEANGQYRIRGLQPGCSYSVRVVPD-KEIVERSIPAQHTVKVANEDVRDINLVAISPLKI 1007
            .|:..::.:|::|:|||:|||.|.|::..: .:.:||::|:...:.|.:.|:.|:|::|...:..
 Frog   979 GEDTVTDEDGKFRLRGLRPGCVYHVQLKSEGNDHIERALPSYRAIGVGSNDIDDVNIIAFRQINQ 1043

  Fly  1008 VDITARVTATLNEHYKTLRIVMYRKGNSDSPVFSQRVGTPVNPKARLNPGITVFFPRIPLDGKSY 1072
            .|::..: .|.:||..||.:.:|:..|.|:|:.|..:|          ..:...||.:..||::|
 Frog  1044 FDLSGNI-ITSSEHLSTLLVKLYKSENLDNPIQSVSLG----------QSLFFHFPPLLRDGENY 1097

  Fly  1073 VVELQSTLSDKTYTYKLPSTTFVADRGSVFVELEFKPEVRAAEADLNQNSISALVLIALVAIAFF 1137
            ||:|.|||....|.|.||..:|........:.|.|.|..:..|.|:.|.|..||.|..|:.:|.:
 Frog  1098 VVQLDSTLPKSQYDYTLPQVSFSTQGYHKHITLTFSPTRKLPEQDVVQGSYLALPLTLLLLLAGY 1162

  Fly  1138 KQDLATSFLSFVWSKLNDV---------------AADLAQRQKSK 1167
            ..|.....|..:.|:|..|               |..|.:|||::
 Frog  1163 NHDKLIPLLLQLTSRLQGVRALGQANSDNGSPEDAKRLPKRQKTR 1207

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1371NP_610551.1 CarboxypepD_reg 120..198 CDD:290350 25/81 (31%)
CarboxypepD_reg 319..>370 CDD:290350 19/51 (37%)
Peptidase_M14NE-CP-C_like 841..905 CDD:304370 35/64 (55%)
CarboxypepD_reg 914..>970 CDD:290350 26/56 (46%)
nomo3NP_001121443.1 CarboxypepD_reg 119..185 CDD:290350 21/66 (32%)
CarboxypepD_reg 319..392 CDD:290350 26/73 (36%)
Cna_B 862..>914 CDD:283411 27/53 (51%)
CarboxypepD_reg 952..>1009 CDD:290350 25/57 (44%)
NTR_like 1042..>1099 CDD:295338 18/68 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C329758425
eggNOG 1 0.900 E1_KOG1948
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H13810
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D361344at33208
OrthoFinder 1 1.000 FOG0003154
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.