| Sequence 1: | NP_523674.1 | Gene: | Cdc2rk / 36051 | FlyBaseID: | FBgn0013435 | Length: | 387 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_012783.1 | Gene: | CTK1 / 853718 | SGDID: | S000001622 | Length: | 528 | Species: | Saccharomyces cerevisiae | 
| Alignment Length: | 357 | Identity: | 118/357 - (33%) | 
|---|---|---|---|
| Similarity: | 203/357 - (56%) | Gaps: | 35/357 - (9%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     2 SSLKSNDVD---------TNPAPDPQAPITRKGFLMSLNTGTPMPIPEQNLFGRCRPVSEFEKLN 57 
  Fly    58 RVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHENIVRLREVVVGK 122 
  Fly   123 SLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRDLKVSNLLMTD 187 
  Fly   188 KGCIKVADFGLARMFSNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCILGELLLGKPL 252 
  Fly   253 LPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQP----YNNLTPKFHMIGQSGRNL 313 
  Fly   314 ---LNILFIYNPKTRATAEECLKSKYFVDPPQ 342 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Cdc2rk | NP_523674.1 | STKc_CDK10 | 45..353 | CDD:173742 | 109/305 (36%) | 
| S_TKc | 53..337 | CDD:214567 | 104/290 (36%) | ||
| CTK1 | NP_012783.1 | STKc_CDK9_like | 183..469 | CDD:270832 | 104/290 (36%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||