DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and CTK1

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_012783.1 Gene:CTK1 / 853718 SGDID:S000001622 Length:528 Species:Saccharomyces cerevisiae


Alignment Length:357 Identity:118/357 - (33%)
Similarity:203/357 - (56%) Gaps:35/357 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSLKSNDVD---------TNPAPDPQAPITRKGFLMSLNTGTPMPIPEQNLFGRCRPVSEFEKLN 57
            ||..|||:.         .:...:.::.|.:|         .|:.:..|.     |..|.:.::.
Yeast   137 SSNTSNDIKNGYHASKYYNHKGQEGRSVIAKK---------VPVSVLTQQ-----RSTSVYLRIM 187

  Fly    58 RVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHENIVRLREVVVGK 122
            :||||:||.||:|::|.:.::|||||:|:..|::|.||:.:|||.:|:...|.|:..::|::| :
Yeast   188 QVGEGTYGKVYKAKNTNTEKLVALKKLRLQGEREGFPITSIREIKLLQSFDHPNVSTIKEIMV-E 251

  Fly   123 SLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRDLKVSNLLMTD 187
            |..:::::.::.:.||:.:|.|.....:.|:.|.:..|:|..::|||...::|||:|.||:|:.:
Yeast   252 SQKTVYMIFEYADNDLSGLLLNKEVQISHSQCKHLFKQLLLGMEYLHDNKILHRDVKGSNILIDN 316

  Fly   188 KGCIKVADFGLARMFSNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCILGELLLGKPL 252
            :|.:|:.||||||.. |.....|.:::|||||.||||||...:.|.||||..||:|.||.....:
Yeast   317 QGNLKITDFGLARKM-NSRADYTNRVITLWYRPPELLLGTTNYGTEVDMWGCGCLLVELFNKTAI 380

  Fly   253 LPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQP----YNNLTPKFHMIGQSGRNL 313
            ..|::|:.|::.|..::|.|:.:.||...|:|..  |.:..|.    .||.:.||..:..|.:.|
Yeast   381 FQGSNELEQIESIFKIMGTPTINSWPTLYDMPWF--FMIMPQQTTKYVNNFSEKFKSVLPSSKCL 443

  Fly   314 ---LNILFIYNPKTRATAEECLKSKYFVDPPQ 342
               :|:| .|:...|.:|.|.|:|.||.:.|:
Yeast   444 QLAINLL-CYDQTKRFSATEALQSDYFKEEPK 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 109/305 (36%)
S_TKc 53..337 CDD:214567 104/290 (36%)
CTK1NP_012783.1 STKc_CDK9_like 183..469 CDD:270832 104/290 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.