DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and DYRK3

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_003573.2 Gene:DYRK3 / 8444 HGNCID:3094 Length:588 Species:Homo sapiens


Alignment Length:249 Identity:80/249 - (32%)
Similarity:128/249 - (51%) Gaps:24/249 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GTPMPIPEQNLFGRCRPVSEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISG 97
            |..:.:|..:|..|      :|.|..:|:||:|.|.|..|.:..:.||||.||.::.   .....
Human   195 GAYIHVPRDHLAYR------YEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKR---FHRQA 250

  Fly    98 LREIMILKQCHHE------NIVRLREVVVGKSLDSIFLVMDFCEQDLASVL-DNMSQPFTESEVK 155
            ..||.||:....:      |::.:.|....:  :.:.:..:....||..:: .|..|.|:...|:
Human   251 AEEIRILEHLKKQDKTGSMNVIHMLESFTFR--NHVCMAFELLSIDLYELIKKNKFQGFSVQLVR 313

  Fly   156 CITLQVLKALKYLHSRFMIHRDLKVSNLLMTDKG--CIKVADFGLARMFSNPPKPMTPQMVTLWY 218
            .....:|::|..||...:||.|||..|:|:...|  ..||.||| :..|..  :.:...:.:.:|
Human   314 KFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFG-SSCFEY--QKLYTYIQSRFY 375

  Fly   219 RAPELLLGCRTHTTAVDMWAFGCILGELLLGKPLLPGNSEIAQLDMIIDLLGAP 272
            ||||::||.| ::|.:|:|:|||||.|||.|:||.||..|..||..:::|||.|
Human   376 RAPEIILGSR-YSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMP 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 77/237 (32%)
S_TKc 53..337 CDD:214567 76/229 (33%)
DYRK3NP_003573.2 Disordered. /evidence=ECO:0000305|PubMed:23415227 1..188
PKc_DYRK2_3 143..522 CDD:271126 80/249 (32%)
S_TKc 209..522 CDD:214567 76/229 (33%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:29973724 468..481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.