DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and MPK2

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_564746.1 Gene:MPK2 / 842248 AraportID:AT1G59580 Length:376 Species:Arabidopsis thaliana


Alignment Length:336 Identity:109/336 - (32%)
Similarity:176/336 - (52%) Gaps:43/336 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHENIVRL 115
            :::..:..:|.|:||:|..:.:..|||.||:||:....|.....:..|||:.:|:...|||:|.|
plant    30 TKYVPIKPIGRGAYGVVCSSVNRESNERVAIKKIHNVFENRIDALRTLRELKLLRHLRHENVVAL 94

  Fly   116 REVVVG---KSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRD 177
            ::|::.   :|...::||.:..:.||..::.: ||..:....:....|:|:.|||:||..::|||
plant    95 KDVMMANHKRSFKDVYLVYELMDTDLHQIIKS-SQVLSNDHCQYFLFQLLRGLKYIHSANILHRD 158

  Fly   178 LKVSNLLMTDKGCIKVADFGLARMFSNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCI 242
            ||..|||:.....:|:.||||||..:...:.||..:||.|||||||||.|..:.|::|:|:.|||
plant   159 LKPGNLLVNANCDLKICDFGLARTSNTKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCI 223

  Fly   243 LGELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNF--TLSQQP---YNNLTPK 302
            ..|||..||:.||...:.|:.:||::||:..|.... |.|.|..:.:  :|...|   ::.|.| 
plant   224 FAELLGRKPVFPGTECLNQIKLIINILGSQREEDLE-FIDNPKAKRYIESLPYSPGISFSRLYP- 286

  Fly   303 FHMIGQSGRNLLNI-----LFIYNPKTRATAEECLKSKYFVDPPQACDPGMMPTFPQHRNNAAPA 362
                   |.|:|.|     :.:.:|..|.:..|.|:..|           |.|.:.         
plant   287 -------GANVLAIDLLQKMLVLDPSKRISVTEALQHPY-----------MAPLYD--------- 324

  Fly   363 PAVQPPADIPI 373
            |:..|||.:||
plant   325 PSANPPAQVPI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 103/314 (33%)
S_TKc 53..337 CDD:214567 100/296 (34%)
MPK2NP_564746.1 STKc_TEY_MAPK 26..363 CDD:143363 109/336 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.