DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and AT4G19110

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_849407.1 Gene:AT4G19110 / 827649 AraportID:AT4G19110 Length:464 Species:Arabidopsis thaliana


Alignment Length:342 Identity:114/342 - (33%)
Similarity:184/342 - (53%) Gaps:31/342 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VSEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVR-----MDQEKDGLPISGLREIMILKQCHH 109
            :..::.:..||:|::|.|:||.:.::.|:||:||::     .|:      ...|||:..|::.:|
plant     1 MDRYKLIKEVGDGTFGSVWRAINKQTGEVVAIKKMKKKYYSWDE------CINLREVKSLRRMNH 59

  Fly   110 ENIVRLREVVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMI 174
            .|||:|:||:  :..|.::.|.::.|.:|..::.:..:.|.|:::|....||.:.|.|:|.|...
plant    60 PNIVKLKEVI--RENDILYFVFEYMECNLYQLMKDRQKLFAEADIKNWCFQVFQGLSYMHQRGYF 122

  Fly   175 HRDLKVSNLLMTDKGCIKVADFGLARMFSNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAF 239
            |||||..|||:: |..||:|||||||..::.| |.|..:.|.||||||:||....:|:.|||||.
plant   123 HRDLKPENLLVS-KDIIKIADFGLAREVNSSP-PFTEYVSTRWYRAPEVLLQSYVYTSKVDMWAM 185

  Fly   240 GCILGELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQPYNNLTPKFH 304
            |.|:.|||..:|:.||.||..::..|..::|.|:|..|....:|....|:...|.|...|:....
plant   186 GAIMAELLSLRPIFPGASEADEIYKICSVIGTPTEETWLEGLNLANTINYQFPQLPGVPLSSLMP 250

  Fly   305 MIGQSGRNLLNILFIYNPKTRATAEECLKSKYFVDPPQAC---DPGMMPTFPQHRNNAAPAPAVQ 366
            ...:...||:..|..::|.:|.||.|.|:..:|    |:|   .|.:.|         .|:.|..
plant   251 SASEDAINLIERLCSWDPSSRPTAAEVLQHPFF----QSCFYVPPSLRP---------KPSVART 302

  Fly   367 PPADIPISDLLNVFIKR 383
            ||...|.....:..:||
plant   303 PPPVGPRGSFEHQSVKR 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 107/310 (35%)
S_TKc 53..337 CDD:214567 102/288 (35%)
AT4G19110NP_849407.1 STKc_MAK_like 4..283 CDD:270824 102/288 (35%)
S_TKc 4..283 CDD:214567 102/288 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.