DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and AT4G10010

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001328367.1 Gene:AT4G10010 / 826592 AraportID:AT4G10010 Length:649 Species:Arabidopsis thaliana


Alignment Length:356 Identity:132/356 - (37%)
Similarity:200/356 - (56%) Gaps:22/356 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NDVDTNPAPDPQAPITRKGFLMSLNT--GTPMP--IPEQNLFGRCRPVSEFEKLNRVGEGSYGIV 67
            :::.|:....|:|.:...|:...|.:  |..:.  :|        |....||||:::|:|:|..|
plant   114 SNIPTSVPHSPEAELIAAGWPSWLTSVAGEAIKGWVP--------RRAESFEKLDKIGQGTYSSV 170

  Fly    68 YRARDTRSNEIVALKKVR---MDQEKDGLPISGLREIMILKQCHHENIVRLREVVVGKSLDSIFL 129
            |||||..:.::||:||||   ||.|.....   .|||.||::..|.|:::|..:|..|...|::|
plant   171 YRARDLETGKMVAMKKVRFVNMDPESVRFM---AREINILRKLDHPNVMKLECLVTSKLSGSLYL 232

  Fly   130 VMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRDLKVSNLLMTDKGCIKVA 194
            |.::.|.||:.:.......||||::||...|:|..|::.|||.::|||:|..|||:.:.|.:|:.
plant   233 VFEYMEHDLSGLALRPGVKFTESQIKCYMKQLLSGLEHCHSRGILHRDIKGPNLLVNNDGVLKIG 297

  Fly   195 DFGLARMF-SNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCILGELLLGKPLLPGNSE 258
            |||||.:: ....:|:|.::|||||||||||||...:...:|:|:.||||.||.||||::||.:|
plant   298 DFGLANIYHPEQDQPLTSRVVTLWYRAPELLLGATEYGPGIDLWSVGCILTELFLGKPIMPGRTE 362

  Fly   259 IAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQPYNN-LTPKFHMIGQSGRNLLNILFIYNP 322
            :.|:..|....|:||:..|.. ..||...:|. .||||.. |...|..:..|...|::.|....|
plant   363 VEQMHKIFKFCGSPSDDYWQK-TKLPLATSFK-PQQPYKRVLLETFKNLPPSALALVDKLLSLEP 425

  Fly   323 KTRATAEECLKSKYFVDPPQACDPGMMPTFP 353
            ..|.||...|.||:|...|..|:...:|.:|
plant   426 AKRGTASSTLSSKFFTMEPLPCNVSSLPKYP 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 124/312 (40%)
S_TKc 53..337 CDD:214567 119/288 (41%)
AT4G10010NP_001328367.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.