DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and Cdk2

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster


Alignment Length:319 Identity:118/319 - (36%)
Similarity:184/319 - (57%) Gaps:22/319 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VSEFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHENIVR 114
            :..|::..::|||:|||||:||...:.:.|||||:|::.|.:|:|.:.:|||.:||...|.|:|:
  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQ 69

  Fly   115 LREVVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRDLK 179
            |.:||:  |.::::::.::...||..::|.....||...:|....|:|.|:.:.|:..::|||||
  Fly    70 LFDVVI--SGNNLYMIFEYLNMDLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLK 132

  Fly   180 VSNLLMTDKGCIKVADFGLARMFSNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCILG 244
            ..|||:...|.||:|||||||.|:.|.:..|.::|||||||||:|||.:.::|.||:|:.|||..
  Fly   133 PQNLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFS 197

  Fly   245 ELLLGKPLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQ------NFTLSQQPYNNLTPKF 303
            |:::.:.|.||:|||.||..|...|..|.|:.|||...||..:      ..|...||...     
  Fly   198 EMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKTKFPRWEGTNMPQPITE----- 257

  Fly   304 HMIGQSGRNLLNILFIYNPKTRATAEECLKSKYFVDPPQACDPGMMPTFPQHRNNAAPA 362
                .....|:..:..|:|..|.:|::.|:..||.: .|..|...:|..|    ||..|
  Fly   258 ----HEAHELIMSMLCYDPNLRISAKDALQHAYFRN-VQHVDHVALPVDP----NAGSA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 114/308 (37%)
S_TKc 53..337 CDD:214567 109/289 (38%)
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 112/299 (37%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 109/289 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442422
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.