DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and sec22b

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_989156.1 Gene:sec22b / 394761 XenbaseID:XB-GENE-999421 Length:215 Species:Xenopus tropicalis


Alignment Length:126 Identity:25/126 - (19%)
Similarity:47/126 - (37%) Gaps:45/126 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RPVS--EFEKLNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHE 110
            ||.|  ||:...:..:.|| |..|||...|:....|:.|:.      :.::.:.|:::.      
 Frog   108 RPYSFIEFDNYIQKTKKSY-IDSRARRNLSSVNTELQDVQR------IMVANIEEVLLR------ 159

  Fly   111 NIVRLREVVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSR 171
                      |::|.::        ...||.|..:|:.:.:.            .|||:.|
 Frog   160 ----------GEALSAL--------DSKASNLSTLSKKYRQD------------AKYLNMR 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 25/126 (20%)
S_TKc 53..337 CDD:214567 21/119 (18%)
sec22bNP_989156.1 Longin 3..126 CDD:341428 5/17 (29%)
R-SNARE_SEC22 132..195 CDD:277219 15/101 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165173164
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.