DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc2rk and CG7028

DIOPT Version :9

Sequence 1:NP_523674.1 Gene:Cdc2rk / 36051 FlyBaseID:FBgn0013435 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001286884.1 Gene:CG7028 / 38032 FlyBaseID:FBgn0027587 Length:912 Species:Drosophila melanogaster


Alignment Length:324 Identity:84/324 - (25%)
Similarity:133/324 - (41%) Gaps:70/324 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GEGSYGIVYRARD-TRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHE------NIVRLRE 117
            |:|.:..|.|.|| .|....||:|.:|   ..:.:..:||||:.|||:.:..      :.:||..
  Fly   599 GQGVFSNVVRGRDQARGQANVAIKIIR---NNEIMHKTGLRELEILKKLNDADPEDRFHCLRLYR 660

  Fly   118 VVVGKSLDSIFLVMDFCEQDLASVLDNMSQPFTE-------------SEVKCITLQVLKALKYLH 169
            ..             |.:|.|..|.:.::....|             ..|:..|.|:..|||.|.
  Fly   661 HF-------------FHKQHLCMVFEPLAMNLREVLKKYGKNVGLHIKAVRSYTQQLFLALKLLK 712

  Fly   170 SRFMIHRDLKVSNLLMTDKGCI-KVADFGLARMFSNPPKPMTPQMVTLWYRAPELLLGCRTHTTA 233
            ...::|.|:|..|:|:.:...| |:.|||.|...|:  ..:||.:|:.:||:||::||. .:...
  Fly   713 KTGILHADIKPDNILVNENNLILKLCDFGSASAISD--NEITPYLVSRFYRSPEIILGI-PYDYG 774

  Fly   234 VDMWAFGCILGELLLGKPLLPGNSEIAQLDMIIDLLG-APSESIWPG-FAD-------------- 282
            :|.|:.||.:.||..||.|..|.|....|...:|:.| .|:..|..| |.:              
  Fly   775 IDTWSAGCTIYELYTGKILFSGKSNNQMLKFFMDVKGKIPNRIIRKGQFREQHFDQSCNFLYHEI 839

  Fly   283 -----------LPAVQNFTLSQQPY---NNLTPKFHMIGQSGRNLLNILFIYNPKTRATAEECL 332
                       :|.|:.....||..   .||....|......::||..:|..:|..|.:..:.|
  Fly   840 DKLTEREKIVVMPVVKPSRSLQQELIADQNLPDDQHRKVTQLKDLLENMFALDPAKRISLNQAL 903

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc2rkNP_523674.1 STKc_CDK10 45..353 CDD:173742 84/324 (26%)
S_TKc 53..337 CDD:214567 84/324 (26%)
CG7028NP_001286884.1 STKc_PRP4 591..908 CDD:271037 84/324 (26%)
S_TKc 599..908 CDD:214567 84/324 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442418
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.