| Sequence 1: | NP_523674.1 | Gene: | Cdc2rk / 36051 | FlyBaseID: | FBgn0013435 | Length: | 387 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031762670.1 | Gene: | cdk16 / 100037876 | XenbaseID: | XB-GENE-5856779 | Length: | 522 | Species: | Xenopus tropicalis |
| Alignment Length: | 357 | Identity: | 124/357 - (34%) |
|---|---|---|---|
| Similarity: | 195/357 - (54%) | Gaps: | 42/357 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 4 LKSNDVDTN---PAPDPQAPITRKGFLMSLNTGTPMPIPEQNLFGRCRPVSEFE----------K 55
Fly 56 LNRVGEGSYGIVYRARDTRSNEIVALKKVRMDQEKDGLPISGLREIMILKQCHHENIVRLREVVV 120
Fly 121 GKSLDSIFLVMDFCEQDLASVLDNMSQPFTESEVKCITLQVLKALKYLHSRFMIHRDLKVSNLLM 185
Fly 186 TDKGCIKVADFGLARMFSNPPKPMTPQMVTLWYRAPELLLGCRTHTTAVDMWAFGCILGELLLGK 250
Fly 251 PLLPGNSEIAQLDMIIDLLGAPSESIWPGFADLPAVQNFTLSQQPYNNLT-PKFH---------M 305
Fly 306 IGQSGRNLLNILFIYNPKTRATAEECLKSKYF 337 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Cdc2rk | NP_523674.1 | STKc_CDK10 | 45..353 | CDD:173742 | 113/313 (36%) |
| S_TKc | 53..337 | CDD:214567 | 107/303 (35%) | ||
| cdk16 | XP_031762670.1 | PKc_like | 189..485 | CDD:419665 | 108/298 (36%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||