DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL42 and C3orf20

DIOPT Version :10

Sequence 1:NP_523673.1 Gene:mRpL42 / 36050 FlyBaseID:FBgn0033480 Length:124 Species:Drosophila melanogaster
Sequence 2:XP_006713404.1 Gene:C3orf20 / 84077 HGNCID:25320 Length:947 Species:Homo sapiens


Alignment Length:87 Identity:20/87 - (22%)
Similarity:37/87 - (42%) Gaps:10/87 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFSSSAVQRNAVGGKSLVEAVAVTKNGRTIVAWHPDT-PV-PYENTLPLPEISEIQSSAVVKESA 74
            |:|..::.|:..|  .|..::|.|...      .|:: || |...|..:...:::.|....:|..
Human   598 LYSGESLLRSQSG--HLESSIAETLKD------EPESAPVSPVRKTTKIHTKAKVTSRGKAREGR 654

  Fly    75 LKTAMRAFKSKHPEVARQELMQ 96
            ..|...|..|..|.|.|:.:::
Human   655 SPTRWAALPSDCPLVLRKLMLK 676

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL42NP_523673.1 MRP-S32 30..121 CDD:462999 15/69 (22%)
C3orf20XP_006713404.1 FAM194 361..570 CDD:464417
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.