DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL42 and mRpL42

DIOPT Version :10

Sequence 1:NP_523673.1 Gene:mRpL42 / 36050 FlyBaseID:FBgn0033480 Length:124 Species:Drosophila melanogaster
Sequence 2:XP_001688738.1 Gene:mRpL42 / 5667124 VectorBaseID:AGAMI1_000931 Length:129 Species:Anopheles gambiae


Alignment Length:64 Identity:16/64 - (25%)
Similarity:24/64 - (37%) Gaps:16/64 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 PLFGW--NRYVPEGNMTACGTDYLSQDFTSRSYILI------------YSGFVY--YLPLFSII 230
            |:.||  ......|::...|:..:..|...|.::|.            .|.|:|  .|||..||
Mosquito   266 PVRGWQGQELSTLGDIIHMGSVAVGADHRDRYFVLFPQTLLFLSVSQRMSAFIYEGKLPLTGII 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL42NP_523673.1 MRP-S32 30..121 CDD:462999
mRpL42XP_001688738.1 MRP-S32 35..126 CDD:462999
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.